SecReT6
Protein ID: 28898177
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1403
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1506800..1508275 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ87PU8
KEGG IDvpa:VP1403
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.60E-187, Aligned region: 66..490
Protein Sequence: 491 a.a.     [Download]
>gi|28898177|ref|NP_797782.1| hypothetical protein VP1403 [Vibrio parahaemolyticus RIMD 2210633]
MSAEAQAPEQEAALVESGSLLDSILNETRLKPSDEGFDVAKRGVEAFISELLSSSNTEKVDQSLVDLMIS
EIDQKLSKQVDAILHNEEVQAIESTWRGLKYLVDHTDFRENIQIELISAKKDEVLDDFEDAPEVVKSGLY
KQIYTREYGQFGGKPVGAVICDYNMSASSPDIKLMEYMANVGAMSHAPFITSASAKFFGLDSYEELPNLK
DLKSVFEGPQYTKWRGLREHEDARYLGLCTSRFMLRTPYSVEDNPIKAFDYDEHVTDSHDNYLWGNSAYA
MASKISESFAKYRWCPNIIGPQSGGSVHDLPVYNFEAMGQIETKIPTEILVSDRREYELAEEGFIALTMR
KGSDNAAFFSANSVQKPKVFANTPEGKQAEMNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERSDLE
IELNKWIRQYVSDQENPPAEVRGRRPLRAAKVEVSDVEGDPGWYKVSMSVRPHFKYMGASFDLSLVGKLD
Q
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1506800-1508275 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGTCTGCAGAAGCACAAGCTCCAGAACAAGAAGCAGCCTTAGTTGAATCAGGCTCACTTCTGGATAGCA
TTCTTAACGAAACTCGTTTAAAGCCAAGTGATGAAGGTTTTGATGTTGCTAAACGTGGCGTAGAAGCATT
CATTAGTGAGCTACTGAGCAGCTCGAATACAGAGAAAGTAGACCAATCTTTGGTTGACTTAATGATCTCT
GAAATCGACCAAAAACTGTCTAAGCAAGTTGATGCGATTCTTCACAACGAAGAAGTTCAAGCGATTGAGT
CAACTTGGCGTGGCCTGAAGTATCTTGTTGATCACACTGATTTCCGTGAGAACATTCAAATCGAACTAAT
TTCAGCGAAGAAAGACGAAGTTCTTGATGATTTTGAAGATGCACCGGAAGTGGTTAAGTCTGGCCTTTAC
AAGCAGATCTACACTCGCGAATACGGCCAATTCGGTGGTAAACCTGTAGGTGCGGTAATCTGTGACTACA
ACATGTCAGCGTCTTCTCCAGACATTAAGCTGATGGAATACATGGCAAATGTGGGCGCGATGTCTCATGC
ACCTTTCATAACGTCAGCATCGGCTAAGTTCTTTGGTCTGGATAGCTACGAAGAGCTACCAAACCTAAAA
GATTTGAAGTCTGTTTTCGAAGGTCCACAATACACGAAATGGCGTGGCTTACGTGAACACGAAGATGCTC
GTTACCTAGGTCTATGTACGTCTCGCTTTATGTTACGTACACCTTACTCTGTCGAAGATAACCCAATTAA
GGCGTTTGACTACGACGAGCACGTAACAGATAGCCATGATAACTACCTATGGGGTAACTCAGCGTACGCG
ATGGCTTCTAAGATCAGTGAGTCATTTGCTAAGTACCGTTGGTGTCCAAATATCATTGGTCCTCAAAGTG
GCGGTTCGGTTCATGACTTGCCAGTTTATAACTTTGAAGCAATGGGCCAAATCGAAACGAAGATCCCAAC
AGAAATCTTGGTATCTGACCGTCGTGAATACGAGCTAGCCGAAGAGGGCTTTATCGCTCTAACGATGCGC
AAAGGTTCTGACAACGCGGCGTTCTTCTCTGCAAACTCTGTTCAAAAACCAAAAGTGTTTGCAAACACGC
CAGAAGGCAAACAAGCAGAGATGAACTACAAGCTGGGTACTCAGCTTCCATACATGTTCATTATCAACCG
TCTAGCGCACTACATCAAAGTGCTACAACGTGAGCAAATCGGTTCATGGAAAGAGCGTTCTGACCTAGAA
ATCGAATTGAACAAGTGGATCCGTCAATACGTTTCTGACCAAGAGAACCCACCAGCAGAAGTCCGTGGTC
GTCGTCCACTGCGTGCTGCTAAGGTTGAGGTATCAGACGTAGAAGGCGATCCAGGCTGGTACAAAGTATC
AATGTCTGTACGTCCTCACTTCAAGTACATGGGCGCAAGTTTCGACTTGTCTCTAGTTGGTAAACTAGAC
CAATAA