SecReT6
Protein ID: 28898178
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1404
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1508283..1508747 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ87PU7
KEGG IDvpa:VP1404
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-20, Aligned region: 43..134
Protein Sequence: 154 a.a.     [Download]
>gi|28898178|ref|NP_797783.1| hypothetical protein VP1404 [Vibrio parahaemolyticus RIMD 2210633]
MKPSSSHSSLAAFFVGPNMEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHLHLADLLNTHSGNAMIDS
EYGLPDFNDVLSNNTNLVRHIQKNITATIERFEPRLLNVEVHYREDHHNPLQLGFGIRGEVSHNGGKVPM
SIDVYMGTDGQFNV
 
Nucleotide Sequence: 465 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1508283-1508747 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
TTGAAACCATCAAGCAGCCATTCTTCACTGGCTGCTTTTTTCGTAGGACCGAACATGGAAAAAGGTTATC
GTCTTTTAGAGCGGATTGAACTAGGTGAGCCAAAAAACTGCTACGAGAAAGTGGTCTCCCACAAGCATTT
GATTGAATCTATTCATTTGCATCTTGCAGATTTGCTGAATACGCATTCTGGTAATGCGATGATCGATAGT
GAATATGGTTTGCCCGATTTTAATGACGTTCTGTCTAATAATACGAATCTCGTTCGCCACATCCAAAAGA
ACATCACAGCGACCATAGAACGCTTTGAACCTCGGCTACTTAACGTCGAAGTTCACTATCGTGAAGACCA
CCACAATCCATTACAGCTCGGTTTTGGTATTCGCGGAGAAGTTTCCCATAACGGCGGTAAAGTTCCAATG
TCGATCGATGTCTACATGGGAACCGACGGCCAATTCAACGTTTAG