SecReT6
Protein ID: 28898179
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1405
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1508758..1510506 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ87PU6
KEGG IDvpa:VP1405
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.50E-192, Aligned region: 5..582
Protein Sequence: 582 a.a.     [Download]
>gi|28898179|ref|NP_797784.1| hypothetical protein VP1405 [Vibrio parahaemolyticus RIMD 2210633]
MSNSKYFQDELTYLRESGSEFAKYHPKLTHFLSEGTFDPDVERLLEGFAFLTGRIREKIDDELPELTQSL
MTLLWPHYMRSIPSLCISELKPHTGSVTEKTVVKRGAEMASEQVEGTQCLFRTCYDVNLYPITITNIEQT
NSRTSSAIDVTLSTEHGLELSRIGLDTLRLHLHGEIHITRTVFLWLFRYLDYVELDVGGGYKHRLGPEYV
KPVGHEEDEALLPYSKNSFAGYRLLQELFSLPDKFMFFDITGLEWLKGIPQRSTVKIKFHFKRALPSEVV
LKDKHLRLHCTPAVNLFEKDGDPIRLEHRRNEYKVRPQSNTQEHYEVYSIEQVESWSKDERRRKPLIEFE
SFEHQINQRDKREFYKSKVGERVSGRGLERYISFHTHNGDIADLGTETVLMKLQCSNADLAERLSVGDIT
YATHKSPTYATFKNITKPTQSVSPQVNGELQWQLIANMSLNYLSLANIDVLKVLLSTYDFHSRVDRQAHR
ASIHRLDGIVSSEMKPIDRVFRGVSVRGNQFKLVTNSKFFVNEGDMFLMATVLNEFIRLYSSVNSFTELE
VFDEATGEVYNWKSLIGQQTIL
 
Nucleotide Sequence: 1749 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1508758-1510506 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
TTGAGTAATAGCAAATACTTTCAAGATGAACTCACATATTTGCGCGAATCGGGTAGTGAATTTGCCAAAT
ATCATCCGAAGTTAACTCACTTTCTCTCTGAAGGAACATTCGACCCAGATGTAGAGCGATTGTTGGAAGG
TTTCGCTTTTCTGACTGGACGTATTCGAGAGAAGATCGATGACGAACTGCCAGAACTGACGCAATCTCTG
ATGACTTTGCTGTGGCCGCATTACATGCGTTCAATTCCATCTTTGTGCATCAGTGAGCTAAAACCCCATA
CGGGAAGTGTTACTGAGAAAACGGTGGTAAAACGTGGCGCAGAAATGGCCAGTGAGCAAGTGGAGGGCAC
GCAATGTCTTTTCCGCACTTGCTACGATGTGAATCTGTACCCAATCACGATCACCAACATTGAACAAACC
AACAGCCGCACCAGTTCAGCGATTGATGTGACGTTGTCGACGGAGCATGGCCTAGAGCTGTCTCGAATTG
GTTTAGATACGTTGCGTTTGCACTTGCATGGTGAGATTCATATTACCCGCACAGTCTTCCTCTGGCTGTT
CCGTTACTTGGATTACGTGGAGTTGGATGTCGGTGGCGGCTATAAACATCGTTTAGGGCCAGAATATGTT
AAGCCGGTAGGGCATGAAGAAGACGAAGCGCTTCTGCCTTACAGCAAAAATTCATTCGCGGGTTATCGTT
TGCTGCAAGAATTATTCTCTTTGCCAGACAAGTTTATGTTCTTCGACATTACAGGTTTGGAGTGGCTAAA
GGGTATTCCACAACGAAGCACAGTGAAAATCAAATTTCACTTTAAACGCGCATTGCCGTCAGAGGTTGTA
CTTAAAGATAAGCACCTAAGGTTGCACTGCACGCCGGCGGTGAATTTGTTTGAAAAAGATGGCGACCCAA
TTCGTTTGGAGCACCGTCGTAACGAATACAAAGTCCGTCCTCAAAGTAATACACAAGAGCACTATGAAGT
GTATTCCATTGAGCAAGTTGAGAGTTGGAGCAAAGACGAGCGTCGCCGTAAACCGTTAATCGAATTCGAA
TCGTTCGAGCATCAAATCAACCAACGAGACAAGCGAGAATTCTACAAGTCGAAGGTAGGAGAGCGTGTTA
GTGGAAGAGGCTTAGAGCGCTATATCTCGTTCCACACTCATAATGGTGATATTGCGGATTTAGGTACGGA
AACCGTACTCATGAAACTGCAATGCAGTAACGCTGATTTGGCCGAACGTCTTTCGGTCGGCGACATTACT
TACGCGACCCACAAATCGCCAACGTATGCGACATTTAAAAACATCACCAAGCCAACACAATCGGTAAGCC
CACAGGTAAACGGCGAGCTTCAATGGCAGTTGATTGCCAACATGTCGCTCAATTATTTGTCTTTGGCAAA
CATTGATGTATTAAAAGTGCTGCTCTCGACCTATGACTTTCATTCTCGTGTTGACAGACAAGCTCACCGA
GCATCGATTCACCGACTCGATGGCATTGTATCGTCAGAGATGAAACCAATTGACCGTGTATTCCGTGGCG
TGTCTGTGCGTGGTAACCAGTTCAAACTAGTAACCAACTCTAAGTTCTTCGTAAATGAAGGCGATATGTT
CCTGATGGCAACGGTACTGAACGAATTCATCCGTTTGTATTCGAGTGTAAACTCCTTTACGGAGCTAGAA
GTATTTGATGAGGCAACCGGCGAAGTATACAACTGGAAAAGCTTAATCGGGCAGCAGACGATTCTATGA