SecReT6
Protein ID: 28898180
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1406
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1510470..1511501 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ87PU5
KEGG IDvpa:VP1406
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.90E-83, Aligned region: 19..328
Protein Sequence: 343 a.a.     [Download]
>gi|28898180|ref|NP_797785.1| hypothetical protein VP1406 [Vibrio parahaemolyticus RIMD 2210633]
MEKLNRAADDSMINTLSEKSNEFSFYQAVLLLEKHYQFEPNSNFVAVGENKYFHQERIEFSVSPNLCFPK
SDMEFIVHMERNGQQYSRVETNFLGLHGSSSPLPVSYTEKLTGREPDDNPVKDFFDFFHNRYTSLLYRVW
KKYRYHVQYQSGATDAFSGRMLHLAGLSGVMQDCGVAELDRAKVLSYVNQLSTRTRSPKLISGIVSHYFS
LPSVRIEEWVYRRVEIADSQRNKLNRANCILGQSFHLGQSIADLNGKFNLCIDDIDFETFKQFSYEGELH
KTLVGLMRFILRDPMSWDLKLTVNLDSIPNNQLGNGEGNNLGQTFWLGNPTDEDVKIRVIGSI
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1510470-1511501 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
CTGGAAAAGCTTAATCGGGCAGCAGACGATTCTATGATTAATACACTTTCTGAAAAATCGAATGAGTTTA
GTTTTTATCAAGCGGTTCTTTTGCTCGAGAAGCACTACCAGTTTGAACCAAACTCTAACTTTGTCGCCGT
GGGAGAGAACAAATATTTCCACCAGGAGCGAATTGAGTTCAGCGTGTCGCCTAATCTATGCTTCCCTAAG
AGTGATATGGAATTTATCGTTCATATGGAACGAAATGGGCAGCAGTATTCACGAGTCGAGACGAACTTCC
TTGGTTTGCATGGTTCGAGCTCTCCATTGCCTGTCTCTTATACGGAGAAACTTACTGGGCGTGAACCTGA
TGACAACCCGGTAAAAGATTTCTTTGATTTCTTCCATAATCGCTACACCAGTTTACTCTATCGTGTCTGG
AAGAAGTACCGTTATCATGTACAGTACCAAAGTGGTGCGACAGACGCTTTTTCTGGACGGATGCTGCACT
TAGCTGGTTTATCAGGTGTTATGCAAGATTGTGGTGTTGCAGAGTTAGACCGTGCAAAAGTCCTGTCTTA
CGTTAATCAACTGTCGACACGTACACGTTCTCCTAAGCTAATTTCAGGTATCGTTTCACATTATTTCTCA
CTTCCTAGCGTTCGCATCGAAGAATGGGTTTATCGCCGTGTGGAGATTGCAGACAGTCAACGAAATAAAC
TCAATCGAGCCAATTGCATATTAGGTCAAAGCTTTCATTTAGGGCAGAGTATCGCAGATTTAAATGGTAA
GTTTAATCTTTGCATTGATGACATTGACTTCGAGACATTTAAGCAGTTTTCTTACGAAGGTGAGTTGCAT
AAAACGTTGGTTGGTTTAATGCGATTCATCTTGCGTGACCCGATGTCTTGGGATCTCAAACTGACAGTTA
ATCTCGACAGCATTCCAAATAACCAACTTGGCAATGGAGAAGGGAACAACTTAGGGCAGACATTTTGGTT
AGGCAATCCCACAGATGAAGATGTGAAGATCAGAGTAATTGGTAGCATTTAG