SecReT6
Protein ID: 28898185
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1411
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1517885..1519399 [+]
Producthypothetical protein
NoteFha
UniProt IDQ87PU0, Q87PU0
KEGG IDvpa:VP1411
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.30E-16, Aligned region: 31..97
FHA [PF00498], Evalue: 2.30E-16, Aligned region: 31..97
Protein Sequence: 504 a.a.     [Download]
>gi|28898185|ref|NP_797790.1| hypothetical protein VP1411 [Vibrio parahaemolyticus RIMD 2210633]
MQTHQLVLFISKCPEEYTGAKHIEMPEGGGSVGRAPSCTLSLTDHNRFISGTHCLISVYGDTFYISDVST
NGTMVNGNKILKNQPISIVEGDVVSLGQYEIGVALEHISAVQDIAADIAPERVSNDPLVNLGEAVVEEEE
KVGALEDLFMETKQDGVNTDDPIAHLKFSMQREDDYLIRDVEKPEPAPAKTIENTRQVVDDSFSIHSEFD
IPNLIPEDWLGGVATSKESVEPAAEQAKQAAFIPEDFAHTKPVSPQASVVQPDVNQPQQPQYEAPLSHAT
SNVTQRAEPVSQKWEEVTQAFVPSAQPTQPETKAKEAQQGFVSNESLAIESVAHSSDIGKAFYEGLGISN
PDLISNEALLFKQMGACLRLCIDNLQKDLHEVESLKGEQGLSEADSNLAELMLTLNSQNLLSPNELVEQM
LDELNDHQIIFNKALNELLIEQSETNDPVMFANDVASKSMFTTKSKLWGEYLEFYANNRRQMNETSLKGL
IKKNYTKAIKGSHA
 
Nucleotide Sequence: 1515 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1517885-1519399 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGCAAACACATCAGCTAGTCCTATTTATTTCTAAATGCCCAGAGGAATATACGGGCGCAAAGCATATTG
AAATGCCAGAAGGTGGTGGCTCAGTTGGACGAGCGCCTAGCTGCACTCTGTCTTTAACGGACCATAACCG
TTTTATCTCTGGTACACACTGTTTGATAAGTGTATACGGTGACACTTTCTACATTAGCGATGTGTCGACA
AATGGCACTATGGTTAATGGTAATAAGATTCTAAAGAATCAACCGATATCTATTGTTGAAGGTGACGTTG
TTTCATTAGGGCAGTACGAGATTGGCGTTGCATTAGAGCATATATCCGCTGTTCAAGATATTGCCGCCGA
TATTGCCCCAGAAAGAGTATCGAATGATCCACTCGTCAATCTCGGTGAGGCGGTCGTAGAAGAGGAAGAA
AAAGTCGGTGCATTAGAAGACTTGTTCATGGAGACCAAGCAAGATGGTGTTAATACTGACGATCCTATTG
CGCATCTAAAGTTTTCGATGCAGCGTGAAGACGACTATCTTATCCGCGATGTTGAAAAGCCTGAGCCTGC
ACCGGCTAAGACAATCGAAAATACGCGACAAGTCGTTGATGACAGTTTCAGTATCCATTCTGAATTCGAT
ATTCCAAATTTAATCCCTGAAGATTGGCTGGGAGGCGTTGCCACGAGTAAAGAATCTGTTGAACCAGCGG
CAGAGCAAGCTAAGCAAGCCGCGTTCATTCCAGAAGATTTTGCGCACACGAAGCCCGTTTCGCCTCAGGC
TAGTGTGGTTCAACCAGACGTTAACCAACCTCAACAGCCTCAATATGAAGCGCCACTTAGTCACGCGACG
TCAAATGTTACTCAAAGAGCAGAGCCTGTTAGCCAGAAATGGGAAGAGGTAACACAAGCCTTTGTTCCAT
CAGCACAACCTACTCAGCCAGAAACGAAAGCGAAAGAGGCCCAACAAGGTTTTGTAAGCAACGAGTCTCT
AGCGATTGAGAGTGTGGCTCATTCTTCAGATATCGGTAAAGCGTTTTATGAAGGCTTGGGTATTAGTAAC
CCTGATCTGATCAGTAACGAAGCTCTGCTGTTTAAACAAATGGGGGCATGTCTTCGTTTGTGTATCGATA
ACTTGCAAAAAGACTTGCATGAAGTTGAGTCACTTAAAGGTGAACAGGGTTTAAGCGAAGCGGATTCAAA
CTTAGCGGAACTGATGTTAACGCTAAATAGTCAGAACTTGCTGTCTCCGAATGAATTGGTGGAGCAAATG
TTGGATGAGCTCAACGATCATCAAATTATTTTTAACAAGGCACTCAATGAGTTGCTAATTGAACAATCAG
AGACGAATGACCCTGTCATGTTTGCAAACGACGTTGCAAGTAAATCCATGTTCACCACCAAATCAAAGTT
ATGGGGTGAGTATCTTGAGTTCTACGCCAATAACCGTCGTCAAATGAATGAGACGTCATTGAAAGGTTTG
ATCAAGAAAAACTACACCAAAGCGATTAAGGGAAGCCATGCGTAG