SecReT6
Protein ID: 28898186
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1412
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1519392..1519892 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ87PT9
KEGG IDvpa:VP1412
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-34, Aligned region: 10..152
Protein Sequence: 166 a.a.     [Download]
>gi|28898186|ref|NP_797791.1| hypothetical protein VP1412 [Vibrio parahaemolyticus RIMD 2210633]
MRSIAILLGCALLSGCAMWDQFKESTGITPETSSIELVIEASSVLNVREGGQSSPVILRVHELTSPVLFR
SLDFFALFENDKASLGDEYIKRYEYQMQPGEKIHEFLELDPATRAVGFSVAFRDIDGSSWRKVEVIEEKS
EYYIKLKLEGSELISDNTRGIEQVYF
 
Nucleotide Sequence: 501 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1519392-1519892 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGCGTAGTATTGCAATATTGCTCGGATGCGCCTTGCTATCCGGTTGTGCCATGTGGGATCAATTTAAAG
AATCAACAGGCATCACGCCTGAAACGTCCTCGATTGAGTTGGTGATTGAGGCGTCTTCGGTTCTAAATGT
TCGTGAAGGCGGACAATCCTCTCCGGTTATTTTGCGAGTTCACGAACTGACGTCACCAGTGTTGTTTCGT
AGCTTAGACTTCTTCGCATTGTTTGAGAACGATAAAGCATCACTGGGTGATGAATACATCAAACGTTATG
AATACCAAATGCAGCCCGGTGAAAAGATCCACGAATTTTTGGAACTCGACCCAGCAACCCGTGCGGTTGG
ATTCTCAGTCGCGTTTCGCGATATTGACGGTTCTTCTTGGCGTAAAGTCGAAGTGATTGAAGAGAAGAGC
GAGTACTACATAAAACTCAAGTTAGAAGGCAGTGAGTTAATTTCTGACAACACTCGCGGCATTGAACAAG
TTTATTTTTAA