SecReT6
Protein ID: 28898187
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1413
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1519904..1521229 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ87PT8
KEGG IDvpa:VP1413
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.00E-140, Aligned region: 19..440
Protein Sequence: 441 a.a.     [Download]
>gi|28898187|ref|NP_797792.1| hypothetical protein VP1413 [Vibrio parahaemolyticus RIMD 2210633]
MSLYNPVVWQDGMFMKPQHFQQLDRSQSKLSSMLSANASPLHWGIKRLEINSQLLALGKIGITRAEGILQ
DRTPFELPLLAELPEVKDVDPSIADKVVYLCCPLPSERSELFGTKKDGARYTLESQEAVDACYDSEDMAN
IVVGKLNFCLMYDHEDKSAYTSIPILKISEVKPDGSVILDESFIPTCIDIHASTVLNKFATEFASMLKHR
AESIVQRLGVVDQQGVSSVSDFMLLQALNRYEPLFWHFASAEGVHPESFYRILLQAEGELSTLCSASRRP
IEFTKYNHGDLTSCLSRTLDSAKMTLSVMSEQRAIPLTLKDQNYGIRTAAIPDSKIIDTTTFILAVKADV
TLDVLHTQFVSQTKIGSIDNIRDLINLQLPGIEIKPMPVVPRALPYHAGYTYFELDKTGEEWAALKNTAA
IAVHVAGDFANLSLQLWAVRL
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1519904-1521229 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGTCTTTATACAATCCAGTTGTTTGGCAAGATGGAATGTTCATGAAGCCGCAGCACTTTCAGCAACTCG
ATCGTTCACAAAGTAAACTGTCGAGCATGCTGAGCGCAAATGCATCACCTTTGCATTGGGGCATTAAGCG
CTTAGAGATTAACTCGCAACTACTGGCGTTGGGCAAAATTGGTATCACTCGCGCTGAAGGTATTCTTCAA
GACAGAACACCATTTGAGCTGCCGCTGCTGGCTGAACTTCCAGAAGTGAAAGACGTTGATCCTTCGATTG
CTGACAAAGTGGTTTACCTTTGTTGTCCGTTACCTTCTGAGCGCTCTGAACTATTCGGCACGAAGAAAGA
CGGCGCACGTTACACGCTGGAATCTCAAGAGGCGGTTGACGCTTGTTATGATTCAGAAGACATGGCAAAT
ATCGTAGTCGGTAAGCTTAACTTCTGCTTGATGTATGACCATGAAGATAAGAGTGCTTACACATCAATTC
CAATTCTGAAGATCTCAGAAGTGAAGCCAGACGGCAGTGTTATCTTGGATGAAAGCTTTATCCCGACTTG
TATCGATATTCATGCCTCTACCGTGCTAAACAAGTTCGCAACCGAGTTTGCCTCTATGCTGAAACACCGT
GCAGAATCCATCGTTCAGCGCTTAGGTGTGGTTGACCAGCAAGGCGTATCTTCAGTTTCTGATTTCATGC
TGCTGCAAGCTCTAAACCGATACGAGCCGCTATTCTGGCACTTTGCGAGCGCAGAAGGGGTTCATCCTGA
ATCGTTTTATCGCATTCTTCTTCAAGCGGAAGGTGAGCTTTCGACTTTGTGTTCAGCATCTCGTCGACCA
ATCGAGTTCACCAAGTACAACCATGGCGACCTAACCAGCTGTCTATCGCGTACATTAGATAGTGCGAAGA
TGACACTAAGTGTGATGTCTGAGCAGCGTGCAATTCCACTGACGTTGAAAGACCAAAACTACGGTATTAG
AACGGCAGCGATTCCAGACAGTAAGATTATCGACACCACGACCTTTATTCTTGCGGTTAAAGCCGACGTT
ACTTTGGATGTTCTTCACACCCAGTTTGTTAGTCAAACGAAGATCGGTTCTATCGATAACATTCGTGACT
TGATTAACCTGCAACTGCCGGGCATCGAGATTAAACCAATGCCAGTCGTACCTCGCGCATTGCCTTACCA
CGCAGGTTACACCTACTTCGAACTGGATAAGACTGGCGAAGAGTGGGCAGCACTGAAAAACACGGCTGCA
ATTGCGGTTCACGTAGCCGGCGACTTTGCTAACTTGTCGCTGCAACTATGGGCAGTTCGTCTATGA