SecReT6
Protein ID: 28898188
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1414
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1521211..1522017 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ87PT7
KEGG IDvpa:VP1414
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.30E-55, Aligned region: 51..253
Protein Sequence: 268 a.a.     [Download]
>gi|28898188|ref|NP_797793.1| hypothetical protein VP1414 [Vibrio parahaemolyticus RIMD 2210633]
MGSSSMSYAETDVTVVLFQPEPGKPMEVMPAPDLSRNIAVQDLNIENMGINPLVDQFSWLIASLSCMSSI
PWLDDPMPFREQVAREIRKGERKLNEMELDRASILVIRYCLCAAIDESVCRQEWGANSHWSQNSLLSEFH
NETSGGDKFFVILERLKADPRKYRHVIEFLYLLLQLGFQGKYGREERGNEKLAEIGNTIYRLVRDERLAE
QEKVSLVNLKAKYLKKPLKRVISPKLILGISAITFAIMYAATYIVIDLKFQQLLEVYR
 
Nucleotide Sequence: 807 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1521211-1522017 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGGGCAGTTCGTCTATGAGTTACGCAGAAACTGACGTTACTGTAGTCTTATTCCAACCAGAGCCAGGCA
AACCGATGGAGGTGATGCCAGCGCCTGACTTGTCTCGTAATATCGCGGTACAAGACCTAAACATCGAAAA
CATGGGCATCAACCCGTTGGTCGACCAGTTCTCATGGTTGATCGCCAGTTTGTCTTGTATGTCTTCGATT
CCTTGGCTTGATGACCCAATGCCGTTTCGTGAACAAGTAGCTCGTGAGATAAGAAAAGGCGAGCGTAAGC
TCAATGAAATGGAACTGGATCGCGCATCCATTTTGGTCATCCGCTACTGTTTGTGTGCTGCGATTGATGA
GTCGGTCTGCCGACAAGAGTGGGGCGCTAACAGCCATTGGAGCCAGAACAGTTTGCTGTCAGAGTTCCAC
AATGAAACATCTGGCGGTGATAAGTTCTTCGTTATTCTCGAGCGATTAAAAGCAGACCCGCGCAAATACC
GTCACGTTATCGAGTTTCTGTATTTGTTGCTTCAACTTGGCTTTCAGGGCAAATACGGCCGTGAAGAGCG
CGGTAACGAAAAGCTAGCAGAAATCGGCAATACAATTTATCGCTTAGTACGTGATGAACGCTTAGCAGAG
CAAGAGAAAGTCTCTCTCGTTAACCTTAAGGCCAAATACCTTAAGAAGCCGTTAAAAAGGGTGATTTCAC
CCAAACTGATTTTAGGCATCAGTGCGATTACCTTCGCAATCATGTATGCCGCGACTTACATCGTCATAGA
TTTAAAGTTTCAGCAATTACTTGAAGTGTATCGATAA