SecReT6
Protein ID: 28898189
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1415
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1522119..1524323 [+]
Producthypothetical protein
NoteVP1415 (e)
UniProt IDQ87PT6
KEGG IDvpa:VP1415
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 2.50E-36, Aligned region: 35..144
DUF4150 [PF13665], Evalue: 2.50E-36, Aligned region: 173..204
DUF4150 [PF13665], Evalue: 2.50E-36, Aligned region: 463..494
AHH [PF14412], Evalue: 9.30E-09, Aligned region: 559..644
Protein Sequence: 734 a.a.     [Download]
>gi|28898189|ref|NP_797794.1| hypothetical protein VP1415 [Vibrio parahaemolyticus RIMD 2210633]
MRSLLLFNQQNSNGLVMGVTVGANGLSIVHKGSGGEANATLPDVCLTKVGKPIVPIPYGNNAKSADLAGG
TTTISMDGGNSVAIKGSTFSKSTGDAGGDKKGVASGTIEAEAKFISASPTVKFEGKGVCRLSDQMTMNKA
NTMCLGGAQNPSVSVTEADDGTFTIDIDYRYPDGDPVYKADFKIIDSTGTEHVGTLSDKGKGTITGLPAG
SISLFLGEDKRDIEPIQKPQPNKDYLELPGPLDLVEFAGRGLVEYWDAVEMPSDYSQWAWGAIMGDFNQD
RSAGQIAFDSAVTAIPFIDQIGDGRDISANLYAFYNADDIREDKEKYTDLVITLVGFIPTAGSLIKGLFK
ELKILGKAADLDMIAAFLRAGAKGDVVKWMQSLDMSVIKNDIYGQLDDITKQVKTLMDTLEQESRKRGYT
VVADAYKRCVEQLDDFFKKADGPISKVLSDFDDRLKMILPEAPLVTSGTSFSISAGTAQGGGKAEVIKTR
NKTKKKTDTCPLCNKKIGKGKKECEGAKVGSISKAVMDDGSSQKLWKEFEIRNGWRDKTEHPWWHGAGAV
QAHHLIPKNAFKLKNAKSKQTKEKMMFLRRIAQTCAYNIDFWKNGIGLPNKKETACFLRKPRHAGGHDRN
EFNYTNECVKLVHDKLSSDIKKRTKEGSCSKTTNSSLIMKFNESSKNIFDNIADFIWFITRDGKNYDPKV
EPYVGCSSNCKKIHPIININTKRQIENYDLEIGK
 
Nucleotide Sequence: 2205 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1522119-1524323 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGCGATCTCTTTTATTATTCAATCAACAAAATTCAAATGGATTGGTTATGGGCGTAACAGTTGGTGCAA
ATGGACTTTCGATAGTTCATAAAGGCTCAGGTGGTGAAGCGAATGCAACGCTCCCAGATGTTTGTTTAAC
GAAGGTCGGTAAGCCGATCGTTCCTATCCCTTATGGCAACAATGCCAAATCAGCAGATCTTGCTGGTGGC
ACTACGACTATCTCTATGGATGGTGGCAACAGTGTCGCAATTAAAGGCAGTACGTTTTCAAAAAGTACCG
GTGATGCGGGCGGCGATAAAAAAGGCGTCGCATCCGGCACGATAGAAGCCGAAGCAAAATTCATTTCAGC
CTCACCAACGGTTAAGTTTGAAGGCAAGGGCGTATGTCGCCTGTCTGATCAAATGACCATGAACAAAGCC
AACACTATGTGTTTGGGCGGCGCACAAAACCCATCGGTTTCTGTTACGGAAGCAGATGATGGAACATTTA
CCATAGACATTGATTATCGATACCCAGATGGAGACCCAGTATACAAAGCCGATTTCAAGATTATTGACAG
TACTGGTACAGAACATGTTGGCACTTTAAGCGACAAAGGTAAGGGGACGATTACGGGCTTACCAGCAGGT
TCTATCAGTTTATTCCTGGGTGAGGATAAGAGAGATATAGAGCCAATCCAAAAGCCGCAACCAAACAAGG
ATTATCTTGAACTGCCGGGGCCTTTGGACTTAGTAGAGTTTGCTGGACGTGGCTTGGTTGAATATTGGGA
TGCTGTTGAAATGCCGAGTGATTATAGTCAATGGGCTTGGGGAGCGATCATGGGGGACTTCAATCAAGAT
CGATCTGCTGGCCAAATTGCTTTTGATAGTGCTGTTACAGCTATACCATTCATCGATCAAATTGGGGACG
GTCGAGACATTAGTGCCAACCTTTATGCTTTTTATAATGCAGACGACATAAGAGAAGATAAAGAAAAGTA
CACAGATCTCGTTATCACTCTAGTTGGCTTTATTCCCACCGCAGGTAGCTTGATAAAAGGGTTATTTAAG
GAACTTAAAATCTTGGGCAAAGCCGCTGATTTAGATATGATTGCTGCTTTCCTTAGAGCCGGAGCAAAAG
GTGATGTGGTCAAATGGATGCAAAGCCTTGATATGTCCGTCATCAAAAATGATATATATGGTCAACTAGA
TGATATTACTAAACAAGTAAAAACGTTAATGGATACACTTGAGCAAGAGAGCCGTAAAAGAGGGTATACT
GTTGTTGCTGACGCCTATAAAAGGTGTGTGGAACAGCTAGATGACTTTTTTAAGAAAGCTGACGGACCAA
TATCTAAAGTCTTAAGCGATTTTGATGATAGGCTCAAGATGATCCTGCCTGAGGCACCTTTAGTTACATC
AGGGACTTCCTTTAGTATTTCTGCAGGGACGGCTCAAGGAGGAGGCAAAGCTGAGGTAATTAAGACTCGT
AATAAGACGAAAAAGAAGACTGATACGTGTCCGTTGTGTAATAAAAAGATTGGAAAAGGGAAGAAAGAGT
GCGAAGGGGCGAAAGTCGGTAGTATCAGCAAAGCAGTTATGGACGATGGTTCCTCTCAAAAATTATGGAA
AGAATTCGAAATACGAAATGGTTGGCGAGACAAGACAGAGCACCCTTGGTGGCACGGGGCGGGAGCAGTG
CAGGCTCACCATCTTATTCCTAAAAATGCATTCAAACTAAAAAATGCAAAGAGTAAGCAAACTAAAGAAA
AAATGATGTTTCTTAGACGAATTGCTCAGACGTGCGCTTACAACATCGACTTTTGGAAAAATGGTATTGG
CCTTCCTAATAAGAAAGAAACAGCGTGTTTTTTGAGGAAACCTCGACATGCAGGCGGTCACGATCGTAAT
GAATTTAACTACACGAACGAATGTGTAAAGCTTGTTCATGACAAGTTAAGCTCAGATATCAAGAAAAGAA
CAAAAGAAGGTAGTTGTTCCAAGACAACAAACTCTTCGTTGATTATGAAGTTCAATGAATCAAGCAAAAA
TATTTTTGATAATATTGCTGACTTTATCTGGTTTATTACTCGTGATGGAAAAAACTATGATCCTAAAGTA
GAACCTTACGTGGGCTGTAGTTCAAATTGCAAAAAAATACACCCGATTATTAATATAAACACTAAGCGAC
AAATTGAAAACTATGACTTAGAGATTGGAAAATAA