SecReT6
Protein ID: 28898190
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1416
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1524323..1524916 [+]
Producthypothetical protein
NoteVP1416 (i)
UniProt IDQ87PT5
KEGG IDvpa:VP1416
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 197 a.a.     [Download]
>gi|28898190|ref|NP_797795.1| hypothetical protein VP1416 [Vibrio parahaemolyticus RIMD 2210633]
MISDINEEYYVLVCGSGKVPSPYVSCSKSHYLIFQEPMSLKMPIRIESAAEAQEKVPLIEAMAAPSDPVL
SGRITQVLNYFDLYKVQLLPAIYTHNDDSEHSYSVLVVDNDIDAYDFDNGLYIDRLDDGEVGNPRNCRLD
PEKLSKIPLEKRYIFKIRGMMDYLVHKTIAESLVALNASGLHLVPVLEWDIGFGMKI
 
Nucleotide Sequence: 594 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1524323-1524916 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGATTTCAGATATTAATGAAGAGTATTATGTACTTGTGTGTGGGTCTGGTAAAGTACCTTCTCCTTATG
TTTCTTGTAGTAAAAGCCACTATTTGATTTTCCAAGAACCTATGTCACTTAAAATGCCAATCCGGATAGA
GTCAGCAGCTGAAGCCCAAGAGAAAGTTCCATTAATCGAAGCTATGGCTGCCCCGAGTGATCCTGTACTT
TCAGGTAGAATAACACAAGTCCTCAACTACTTTGATCTTTATAAAGTTCAATTGCTCCCAGCTATATATA
CCCATAATGATGATAGCGAGCACTCTTATTCAGTCTTAGTTGTTGATAACGATATTGATGCTTACGATTT
TGATAACGGCCTATATATTGATCGTTTGGATGATGGTGAGGTTGGAAACCCAAGAAACTGTCGACTTGAC
CCCGAAAAACTTTCAAAAATCCCGTTAGAAAAACGTTATATTTTTAAAATACGGGGCATGATGGATTATT
TAGTCCACAAAACAATTGCCGAATCTCTAGTCGCATTGAATGCAAGTGGACTTCACTTAGTTCCAGTATT
GGAATGGGACATTGGTTTTGGAATGAAAATTTAA