SecReT6
Protein ID: 28900880
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1025
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1079347..1079637 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ87HE0, Q87HE0
KEGG IDvpa:VPA1025
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.90E-24, Aligned region: 1..17
PAAR_motif [PF05488], Evalue: 2.90E-24, Aligned region: 17..86
DUF4150 [PF13665], Evalue: 3.30E-07, Aligned region: 28..49
DUF4150 [PF13665], Evalue: 3.30E-07, Aligned region: 58..83
PAAR_motif [PF05488], Evalue: 2.90E-24, Aligned region: 1..17
PAAR_motif [PF05488], Evalue: 2.90E-24, Aligned region: 17..86
DUF4150 [PF13665], Evalue: 3.30E-07, Aligned region: 28..49
DUF4150 [PF13665], Evalue: 3.30E-07, Aligned region: 58..83
Protein Sequence: 96 a.a.     [Download]
>gi|28900880|ref|NP_800535.1| hypothetical protein VPA1025 [Vibrio parahaemolyticus RIMD 2210633]
MGKPAAVIGSFHLCPKKTGKIPHVGGPVVMGSPNVKIGGIPAARKGDKLVCIGPPDSISAGSSSVKINGK
PAARSGDSTSHGGKILVGVPTVLIGG
 
Nucleotide Sequence: 291 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1079637-1079347 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGGGTAAACCAGCAGCAGTGATTGGAAGTTTTCACCTTTGTCCAAAGAAAACAGGCAAGATCCCTCATG
TTGGAGGTCCTGTAGTTATGGGTTCTCCAAATGTAAAAATAGGAGGCATCCCTGCCGCGAGAAAAGGTGA
CAAACTCGTTTGTATCGGACCGCCTGACAGCATATCTGCGGGGTCTTCTAGCGTTAAGATTAATGGTAAA
CCGGCTGCTAGATCAGGGGACTCTACATCTCATGGTGGAAAAATTCTCGTCGGTGTACCGACCGTCCTCA
TCGGGGGATAG