SecReT6
Protein ID: 28900881
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1026
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1079651..1081486 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ87HD9
KEGG IDvpa:VPA1026
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.70E-57, Aligned region: 30..335
Phage_base_V [PF04717], Evalue: 2.10E-24, Aligned region: 377..470
Protein Sequence: 611 a.a.     [Download]
>gi|28900881|ref|NP_800536.1| hypothetical protein VPA1026 [Vibrio parahaemolyticus RIMD 2210633]
MKKASQDNNFIRISSPFGKDALILNSFEYREGISELFSLRAKAYFNDQKNELNEIVGKEVTISVENSSRV
SKSPRFFHGIVSAAKLEGQRVMNSHNGENYKNIEIIVEPKVKFAAYRNNCKIFQKKNIKDIISEVLSEHG
VAFKFELKNTYPQYSYKVQYEESDLAFVQRLLAEEGLSFCFSHSKSSHVLDIFDDVSFYKPSPEFMVDFD
TGSSESSHISAWNETQVLTTKSSQKSGFNMLKPASQPKNVAAGDTALFTVPASEYFEYLGETESDDQYSL
RNTHAIESLQQNVYLCSGEASCRTFSVGKCFKFKKHEDKSRVGKEYVLASVTIFASVFNQTGLGGTASQG
VRVAFTCVDSKTILRPAVTYPKPQIKGLQTAIVTGNKDGEVYVDKHGRIKVQFHWDRLGKYDVNSSCWIR
VAQSVAGNGWGAVFHPRVGQEVIVEFVNGDPDQPIVTGALYNGSQLPPYSLPEKSSQSGFKSRSVQKGNA
NFNELRFEDKPGEEHIYLHAEKLFQMLVEDCVDIVVENNKVEKVTNDVTQDVGKNATLKVGENYTSDTGK
VLSLNAGKSIEIKVGGASIQMSSSGEINIKGNKISINGSAIALKAGQISLN
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1081486-1079651 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGAAAAAAGCAAGTCAAGACAACAACTTTATCCGTATTTCTTCTCCGTTTGGAAAAGATGCTCTTATTC
TCAATTCGTTCGAATATAGAGAAGGGATCTCGGAGCTTTTTTCATTGCGTGCTAAAGCTTATTTTAATGA
TCAAAAAAATGAGCTCAATGAAATCGTGGGTAAAGAAGTAACGATTTCAGTGGAAAATAGTAGTCGTGTT
TCTAAAAGTCCGCGTTTTTTCCATGGCATTGTCTCTGCTGCAAAGCTCGAAGGCCAGAGAGTGATGAATT
CTCATAATGGAGAAAACTACAAAAATATTGAAATTATTGTTGAACCGAAAGTTAAGTTCGCAGCGTACAG
AAATAATTGTAAAATCTTTCAGAAGAAAAATATAAAAGACATTATTTCCGAAGTGCTTTCAGAGCATGGT
GTTGCATTTAAATTTGAACTAAAAAATACGTATCCCCAATATTCCTACAAAGTTCAGTATGAAGAATCTG
ATCTTGCTTTTGTTCAGCGCCTCCTAGCCGAAGAAGGGCTCTCTTTTTGCTTTAGTCACTCTAAATCATC
CCATGTCCTAGATATTTTTGATGATGTAAGCTTTTACAAACCCAGTCCTGAGTTTATGGTCGATTTCGAT
ACAGGCAGTTCAGAGTCGAGTCACATTTCTGCTTGGAACGAAACACAAGTTTTAACGACTAAATCAAGCC
AGAAGTCTGGCTTCAATATGCTAAAACCAGCCTCACAACCCAAAAACGTAGCTGCTGGTGATACTGCACT
GTTTACCGTACCTGCGAGTGAGTATTTTGAGTATCTGGGTGAAACAGAAAGTGACGATCAGTACTCGCTT
CGAAACACTCACGCAATTGAATCCCTTCAACAGAACGTTTATCTATGTAGCGGAGAGGCGAGTTGTCGAA
CCTTTTCTGTGGGTAAATGTTTTAAGTTCAAAAAACACGAAGATAAATCGCGAGTAGGAAAAGAATATGT
CTTGGCCTCTGTGACGATTTTTGCTTCGGTGTTTAATCAAACTGGTCTGGGTGGCACCGCTTCTCAAGGT
GTTCGTGTTGCGTTTACTTGTGTGGACTCTAAAACCATTTTAAGGCCGGCGGTTACTTACCCTAAACCGC
AAATTAAAGGTCTTCAAACAGCCATTGTGACTGGTAATAAAGACGGTGAGGTATACGTTGATAAACATGG
CAGAATAAAAGTACAGTTCCATTGGGATCGTTTGGGTAAGTACGATGTAAATAGTTCGTGTTGGATTCGA
GTTGCTCAAAGTGTTGCCGGAAATGGATGGGGTGCGGTGTTTCATCCTCGGGTAGGGCAAGAGGTTATCG
TAGAGTTTGTGAATGGCGACCCAGATCAACCTATTGTCACGGGTGCGCTGTATAACGGGAGCCAGTTGCC
CCCGTATTCTCTTCCAGAGAAAAGTTCTCAAAGCGGTTTTAAGTCCCGCTCAGTTCAAAAAGGAAACGCC
AATTTCAACGAGTTACGCTTTGAAGATAAACCTGGCGAAGAACACATTTACCTTCACGCAGAAAAGTTGT
TCCAAATGTTAGTCGAAGACTGCGTGGATATTGTGGTTGAGAACAATAAAGTTGAGAAAGTAACCAACGA
TGTAACTCAAGACGTTGGAAAAAATGCGACGTTAAAAGTGGGAGAGAACTATACCTCTGACACTGGAAAA
GTGTTGTCTCTCAATGCAGGGAAAAGTATTGAAATTAAAGTCGGTGGAGCCTCAATTCAAATGTCGAGTT
CTGGCGAAATCAACATTAAGGGCAACAAGATTTCTATCAATGGCTCTGCAATCGCATTGAAAGCAGGACA
AATCTCTTTGAATTAA