SecReT6
Protein ID: 28900882
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1027
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1081544..1082023 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ87HD8
KEGG IDvpa:VPA1027
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-30, Aligned region: 6..134
Protein Sequence: 159 a.a.     [Download]
>gi|28900882|ref|NP_800537.1| hypothetical protein VPA1027 [Vibrio parahaemolyticus RIMD 2210633]
MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTITKLQDRSSPD
LFKEATIGKGKPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPVETITISYTEMMMTVTPTDDK
NNTSAPLVYGYSGVKGQQM
 
Nucleotide Sequence: 480 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1082023-1081544 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGCAGTCTAATACGTATCTTAAATACGCAGATATTAAAGGTGAAGCGACAGCGGAACAATATAAGGATT
TAATTACACTACTATCTGTAGATTGGAGTGTTGGTCGTGAAATTTCTTCTTACACGGGTACAGCAATGGA
CCGTGAAGCAAGTGCAACACGCCTATATGATTTAACTATCACTAAACTTCAAGATCGTTCGTCTCCTGAT
CTATTCAAGGAAGCAACAATCGGTAAAGGTAAACCTGCAGTATTCCACATCACTAAGCAGGGCGAAAAAG
TTGAAGAAATCATGAAAATCGAACTGACTGATGCGATGATTTCTAACTACTCAGTATCGATTCAAGATGA
TCGCCCAGTAGAAACTATCACAATTTCATACACTGAAATGATGATGACAGTGACACCTACTGATGACAAA
AACAACACTTCTGCTCCGTTGGTTTACGGTTACAGCGGTGTTAAAGGTCAACAAATGTAA