SecReT6
Protein ID: 28900883
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1028
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1082229..1084796 [-]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDQ87HD7
KEGG IDvpa:VPA1028
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 213..233
AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 588..753
AAA [PF00004], Evalue: 1.00E-20, Aligned region: 157..205
AAA [PF00004], Evalue: 1.00E-20, Aligned region: 213..344
AAA [PF00004], Evalue: 1.00E-20, Aligned region: 593..711
AAA_16 [PF13191], Evalue: 4.20E-13, Aligned region: 190..234
AAA_16 [PF13191], Evalue: 4.20E-13, Aligned region: 256..291
AAA_16 [PF13191], Evalue: 4.20E-13, Aligned region: 478..480
AAA_16 [PF13191], Evalue: 4.20E-13, Aligned region: 561..628
AAA_16 [PF13191], Evalue: 4.20E-13, Aligned region: 657..686
AAA_5 [PF07728], Evalue: 1.70E-12, Aligned region: 213..235
AAA_5 [PF07728], Evalue: 1.70E-12, Aligned region: 592..713
ClpB_D2-small [PF10431], Evalue: 4.40E-11, Aligned region: 760..833
AAA_22 [PF13401], Evalue: 2.10E-08, Aligned region: 37..83
AAA_22 [PF13401], Evalue: 2.10E-08, Aligned region: 212..294
AAA_22 [PF13401], Evalue: 2.10E-08, Aligned region: 330..385
AAA_22 [PF13401], Evalue: 2.10E-08, Aligned region: 590..623
Sigma54_activat [PF00158], Evalue: 5.40E-08, Aligned region: 209..235
Sigma54_activat [PF00158], Evalue: 5.40E-08, Aligned region: 573..710
AAA_14 [PF13173], Evalue: 2.60E-07, Aligned region: 213..325
AAA_14 [PF13173], Evalue: 2.60E-07, Aligned region: 590..680
AAA_19 [PF13245], Evalue: 1.10E-06, Aligned region: 213..234
AAA_19 [PF13245], Evalue: 1.10E-06, Aligned region: 586..615
IstB_IS21 [PF01695], Evalue: 9.70E-06, Aligned region: 207..235
IstB_IS21 [PF01695], Evalue: 9.70E-06, Aligned region: 592..623
AAA_18 [PF13238], Evalue: 1.20E-05, Aligned region: 213..279
AAA_18 [PF13238], Evalue: 1.20E-05, Aligned region: 593..632
Arch_ATPase [PF01637], Evalue: 1.70E-05, Aligned region: 192..232
Arch_ATPase [PF01637], Evalue: 1.70E-05, Aligned region: 265..361
Arch_ATPase [PF01637], Evalue: 1.70E-05, Aligned region: 586..620
Clp_N [PF02861], Evalue: 1.70E-05, Aligned region: 24..74
Clp_N [PF02861], Evalue: 1.70E-05, Aligned region: 110..141
AAA_17 [PF13207], Evalue: 8.50E-05, Aligned region: 213..272
AAA_17 [PF13207], Evalue: 8.50E-05, Aligned region: 458..501
AAA_17 [PF13207], Evalue: 8.50E-05, Aligned region: 591..627
NTPase_1 [PF03266], Evalue: 9.80E-05, Aligned region: 213..235
NTPase_1 [PF03266], Evalue: 9.80E-05, Aligned region: 264..289
NTPase_1 [PF03266], Evalue: 9.80E-05, Aligned region: 592..629
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 213..233
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 584..633
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 205..229
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 586..603
AAA_25 [PF13481], Evalue: 0.00023, Aligned region: 213..286
AAA_25 [PF13481], Evalue: 0.00023, Aligned region: 588..614
AAA_25 [PF13481], Evalue: 0.00023, Aligned region: 655..676
NACHT [PF05729], Evalue: 0.0006, Aligned region: 213..241
NACHT [PF05729], Evalue: 0.0006, Aligned region: 592..616
T2SE [PF00437], Evalue: 0.00097, Aligned region: 204..235
T2SE [PF00437], Evalue: 0.00097, Aligned region: 580..624
UPF0079 [PF02367], Evalue: 0.0016, Aligned region: 213..233
UPF0079 [PF02367], Evalue: 0.0016, Aligned region: 579..621
AAA_30 [PF13604], Evalue: 0.0025, Aligned region: 210..235
AAA_30 [PF13604], Evalue: 0.0025, Aligned region: 465..487
AAA_30 [PF13604], Evalue: 0.0025, Aligned region: 586..620
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 65..96
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 211..232
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 279..293
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 547..613
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 660..686
TIP49 [PF06068], Evalue: 0.0028, Aligned region: 213..234
TIP49 [PF06068], Evalue: 0.0028, Aligned region: 282..291
TIP49 [PF06068], Evalue: 0.0028, Aligned region: 559..628
DUF258 [PF03193], Evalue: 0.0031, Aligned region: 209..232
DUF258 [PF03193], Evalue: 0.0031, Aligned region: 479..511
DUF258 [PF03193], Evalue: 0.0031, Aligned region: 576..603
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 214..234
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 593..616
RNA_helicase [PF00910], Evalue: 0.006, Aligned region: 693..711
Protein Sequence: 855 a.a.     [Download]
>gi|28900883|ref|NP_800538.1| ClpA/B-type chaperone [Vibrio parahaemolyticus RIMD 2210633]
MASLSLSALVERLSPQAKETLEQAAAMASSRTHHSIELTHWLLTIVQHPSGIYSEVFEAFDIDERKVEEQ
LQAQLEKYKTGCQTVPGLSAHTVTIMQNALMCATIEFHEEQVNCIHLLFAYLSDDTLVNMMNAISAELDK
VEPSRLVVMKEHVGDGGNNTSKATSSSNSALNQFTTDLTEQAKAGKIDPVIGRDNEIRLMIDILLRRRQN
NPILTGEAGVGKTAVIEGLAQKIVDGDVPPALHDVAIKSLDLALLQAGAGMKGEFENRLKNLIREVNESS
QPIILFIDEAHGLIGGGGQAGQGDAANILKPALARGELRTIAATTWAEYKKYFEKDAALTRRFQVVKVDE
PTPELAVDMLRGLVNIMGQHHDVYITSQALNAAVQLSARYINGRQLPDKAVSVLDTACSRVALSQSATPG
ALDSKKKKLNIKEAEFQQLTKEAQLGVSHDELLNNIRYEIDELSNQVIELEAIWEQEKQWVQEAKSLRAR
VIEENADCDKERLQEIESNLALNAQPLVFSHVNESLIAEVISDWTGIPLGKLQDDEIEAVLNLKDSLCER
VVGQDHALEIMSEVIKTASAQLTDETKPNGVFLLTGPSGVGKTESALAIAEKVYGSEDNVTTINMSEFKE
EHKVSLLLGSPPGYVGYGEGGVLTEAVRRKPYSVILLDEMEKAHPGVQDIFYQVFDKGSIKDGEGRDIDF
KNTIIIMTANTGTETTMSLYADPDLAPEPEALKEALRDDLLTDFKPAFLGRVNVLPYLPLGKEVLTEITK
LKLNKVSNRIRKHYSAGLYFDEQLINDIVDNSNESGSGARVVQTTIENNLLPKISHEILNAILNGKTFDE
INVRGSIKELEVSLI
 
Nucleotide Sequence: 2568 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1084796-1082229 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGGCTTCATTATCACTTTCAGCGTTGGTCGAAAGATTGTCTCCGCAAGCGAAGGAAACGCTAGAGCAAG
CGGCTGCAATGGCAAGTTCGCGTACACATCATAGTATAGAGTTGACCCACTGGTTGTTGACGATAGTTCA
ACATCCATCCGGTATTTATTCAGAAGTGTTTGAAGCTTTTGATATTGATGAAAGAAAAGTCGAAGAACAA
CTGCAAGCTCAGCTAGAAAAATACAAAACGGGATGCCAAACCGTCCCAGGCCTTTCTGCTCATACTGTAA
CCATTATGCAGAATGCTTTGATGTGCGCAACGATAGAGTTTCATGAAGAACAAGTGAACTGTATCCACTT
ACTGTTTGCGTATCTTTCTGATGACACGCTAGTGAATATGATGAACGCTATTAGCGCGGAGCTAGACAAA
GTCGAACCATCTCGCCTAGTCGTAATGAAAGAGCATGTGGGCGATGGTGGAAACAATACTTCTAAGGCGA
CGAGCAGCTCGAACTCTGCATTGAATCAGTTCACAACGGATCTTACTGAGCAAGCTAAAGCTGGAAAAAT
AGATCCTGTTATCGGTCGCGACAATGAAATCCGCTTGATGATCGATATCTTATTGCGTCGCCGCCAAAAC
AATCCGATCTTAACGGGTGAGGCAGGCGTAGGTAAAACTGCGGTAATTGAGGGGCTGGCGCAAAAAATAG
TGGATGGGGATGTTCCTCCTGCTTTACATGATGTTGCCATCAAATCACTCGATCTTGCTTTGCTTCAGGC
GGGTGCGGGGATGAAAGGGGAGTTTGAAAATAGACTTAAAAATCTCATTCGAGAAGTGAACGAATCTTCG
CAGCCAATCATTCTTTTTATCGATGAAGCTCATGGTCTAATCGGAGGTGGTGGTCAAGCGGGACAAGGTG
ATGCTGCTAATATATTGAAACCAGCGTTGGCTCGAGGAGAGTTACGGACCATCGCTGCAACTACTTGGGC
TGAGTACAAAAAATATTTTGAAAAAGATGCTGCGTTAACGAGGCGCTTCCAGGTTGTGAAAGTAGACGAG
CCGACTCCTGAGTTAGCGGTAGATATGCTTAGAGGCTTGGTTAACATCATGGGGCAACATCATGATGTCT
ATATCACAAGCCAAGCACTGAATGCTGCGGTACAACTTTCTGCTCGCTACATTAACGGACGCCAACTGCC
AGATAAAGCAGTATCGGTATTAGATACAGCATGTTCGCGTGTTGCATTGAGCCAATCTGCCACGCCGGGC
GCGTTGGATAGCAAAAAGAAAAAGCTAAACATCAAAGAAGCTGAGTTTCAACAACTTACCAAAGAGGCTC
AATTGGGCGTAAGTCACGATGAACTGCTTAATAATATTCGGTATGAGATCGATGAGTTATCTAATCAAGT
CATAGAATTAGAGGCAATTTGGGAACAAGAAAAGCAGTGGGTTCAAGAAGCTAAGTCGTTGAGAGCTAGG
GTGATAGAAGAGAATGCCGACTGTGACAAAGAGCGATTACAGGAAATCGAATCGAACTTAGCGCTCAACG
CCCAACCTTTAGTCTTTTCTCATGTGAATGAATCTTTGATTGCTGAGGTGATTTCTGATTGGACAGGCAT
TCCACTTGGAAAATTGCAAGATGACGAAATTGAAGCGGTTCTTAACCTAAAAGATAGCTTGTGCGAGCGA
GTGGTGGGGCAAGATCATGCTCTAGAAATCATGTCCGAAGTGATCAAAACAGCAAGTGCCCAATTGACGG
ATGAAACCAAACCTAATGGCGTGTTTTTATTAACTGGCCCTAGTGGTGTCGGAAAAACGGAATCCGCTCT
TGCTATCGCAGAGAAAGTTTATGGGAGCGAAGACAACGTAACCACGATAAATATGTCGGAATTCAAAGAA
GAGCATAAGGTTTCATTGTTGTTAGGCTCTCCACCTGGATATGTCGGATACGGTGAGGGGGGCGTTCTAA
CGGAAGCCGTAAGGCGTAAACCTTACAGTGTGATTCTGTTGGATGAAATGGAAAAAGCGCACCCCGGTGT
GCAAGATATTTTCTATCAAGTGTTTGATAAAGGCTCCATTAAAGATGGTGAAGGTCGAGATATCGATTTT
AAAAACACCATCATTATCATGACGGCGAATACTGGCACAGAAACCACAATGTCTCTCTATGCAGATCCAG
ATTTAGCGCCAGAACCGGAAGCTTTAAAAGAAGCGCTTAGAGATGACTTGCTAACAGATTTTAAACCTGC
ATTTTTGGGGCGGGTTAATGTATTACCTTACTTGCCTCTCGGAAAAGAAGTCCTAACGGAAATAACTAAG
TTAAAACTCAACAAAGTATCTAACCGTATCCGAAAACATTATTCGGCAGGGTTGTATTTTGATGAACAAC
TAATTAATGACATTGTAGACAATAGTAATGAGTCAGGAAGTGGTGCTCGTGTAGTTCAAACCACCATTGA
AAATAATTTACTTCCTAAAATTTCTCATGAAATATTGAATGCAATTCTTAATGGTAAGACGTTCGATGAA
ATTAATGTTAGAGGTTCAATTAAAGAACTAGAAGTCTCACTTATTTAA