SecReT6
Protein ID: 28900884
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1029
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1084807..1085772 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ87HD6
KEGG IDvpa:VPA1029
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.00E-75, Aligned region: 8..307
Protein Sequence: 321 a.a.     [Download]
>gi|28900884|ref|NP_800539.1| hypothetical protein VPA1029 [Vibrio parahaemolyticus RIMD 2210633]
MSSEDFYRELKQRSLFEAIHLIEQELLKVESQIGTDALPKNEKLNLKVNASLGFENAQLVSTKPLGKDKL
ALETNLIGLTGEQGVLPQHYSELALHRLKEGDHAMVDFYDIFNHRLLSLYYRSWQLSQLTIQARAHAKNQ
RSPLTDCMSSLTGGGNDLALHYGGMYASPTRSKGALKSILECLSGCQIRIHEFQGQWMRLSKSEQTRLVS
KSMPEGQFAQLGAGASLGKKAWNINASTTIEFLPKESKQVTNLLPKTNTLKTIKQVAGDFIGKHKHVKWQ
LTTKHSLLPQVQISKQQGQLGVGSVLKKHERTEDRNITITV
 
Nucleotide Sequence: 966 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1085772-1084807 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGAGCTCAGAGGACTTCTACCGCGAGCTAAAGCAACGTTCTTTGTTTGAAGCTATTCATCTTATTGAGC
AAGAGCTTTTGAAAGTTGAATCGCAAATTGGAACAGATGCATTACCCAAAAACGAGAAACTCAACTTAAA
GGTCAATGCGTCTTTAGGCTTTGAGAATGCGCAACTCGTTTCTACTAAACCATTAGGTAAAGATAAATTA
GCGCTTGAGACAAATTTGATTGGCTTGACGGGGGAGCAGGGTGTACTGCCTCAGCATTACAGTGAGCTTG
CATTACATCGACTGAAAGAAGGCGATCATGCGATGGTGGACTTCTATGACATTTTTAACCATCGGCTTTT
ATCCCTCTATTATCGAAGTTGGCAGTTGAGTCAGTTAACCATACAAGCGCGTGCGCATGCAAAAAATCAG
CGCTCCCCATTAACTGATTGCATGTCGTCATTGACTGGCGGTGGGAATGATCTAGCACTGCATTATGGCG
GCATGTATGCATCTCCAACACGAAGTAAAGGTGCATTGAAGAGCATTTTGGAATGTTTGTCTGGTTGCCA
AATTCGTATTCACGAGTTTCAAGGTCAATGGATGCGACTGTCTAAATCTGAACAAACTCGTTTGGTATCG
AAAAGTATGCCCGAAGGCCAGTTTGCACAACTCGGTGCTGGTGCGTCACTAGGGAAAAAAGCCTGGAATA
TCAATGCAAGTACAACAATTGAGTTTCTCCCAAAGGAAAGTAAGCAAGTCACAAATCTGTTACCCAAGAC
CAATACATTGAAAACGATAAAACAGGTCGCAGGTGACTTCATTGGCAAACACAAGCACGTTAAATGGCAA
CTCACGACTAAACATAGTCTATTGCCTCAAGTTCAAATATCTAAGCAACAAGGTCAGTTAGGTGTCGGCT
CTGTACTGAAAAAACATGAACGTACGGAAGATCGCAACATAACAATTACGGTTTAA