SecReT6
Protein ID: 28900885
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1030
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1085769..1087592 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ87HD5
KEGG IDvpa:VPA1030
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.20E-191, Aligned region: 5..607
Protein Sequence: 607 a.a.     [Download]
>gi|28900885|ref|NP_800540.1| hypothetical protein VPA1030 [Vibrio parahaemolyticus RIMD 2210633]
MSEEFLKYYNRELAYLRHKGQEFGEQYPKIAARLRISEEQVEDPHVERLLEGCAFLTARIRQSLDNSYPQ
FTESLMGQLYPDFHAPIPSMSVIKLNCSESTTSSFAIPVGERVEVSAPGYQDCQFRTGYPTTMYPLDIIS
GSFENAPFKPTGSKWEHNAHSVLRCQLSAHDSESSINSMGIDCLRLYLNGQTQLTLKLYQMLFQSLIGLS
IVLDGKEIMPLTKRHLQSVGFGDEEQVVPYSKRSFSGSRLLVEYLHFPEKFMFFDLIELGLDKLEIQGQV
EICFYFDTSDDWLPKQVDEESVMVGCVPIVNLFKSTMEPKRLLPTEYEYQLSPQYQDAESNEVVSISDVT
LRNWNKTYEHLPCYHSGEHTHYMSASEVYWLMRREDKNWAGGYDEPGRETYVSFVDKQYQLFSPESRDNW
LMYVEAECCNRNLPQKIPFGGGLPKVQLPNVDDNFKSIRCLTSLSETLRPEMDESTRWQLTKLLTLNHFT
EADGLATLKQTLNLYAFAGTAETKAVIDALVKLEFEHTTGRVSQKGKVGFAHGVKLVLTVSDQILPKEQI
FLLGSVLSVYFAQYAEINVFTQLEIKLKSTSSSFHVWPALTGDKVLL
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1087592-1085769 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGAGTGAAGAGTTTCTAAAATACTACAATCGTGAATTGGCCTATCTGCGACACAAAGGGCAAGAGTTTG
GCGAGCAATATCCTAAAATTGCGGCTAGGTTACGTATCAGCGAAGAACAAGTTGAAGACCCACATGTTGA
ACGTCTGTTGGAAGGTTGTGCTTTTTTAACCGCTCGGATAAGACAAAGTCTGGATAACAGTTACCCACAG
TTTACGGAATCACTGATGGGACAGCTATATCCGGACTTTCATGCGCCAATTCCTTCGATGTCCGTGATCA
AATTGAACTGTTCAGAGTCAACCACTAGTTCATTTGCTATTCCTGTGGGTGAAAGAGTCGAAGTTAGTGC
CCCTGGATATCAAGATTGCCAGTTTCGAACCGGTTACCCGACAACAATGTATCCACTCGATATTATCTCT
GGTTCATTTGAGAACGCGCCTTTCAAGCCTACTGGCTCTAAGTGGGAGCATAATGCGCACTCTGTACTAA
GGTGTCAGCTGAGTGCTCATGATTCAGAGTCCTCTATCAATTCCATGGGTATCGATTGTTTGCGTTTGTA
CTTAAATGGACAGACGCAATTAACACTCAAGCTATATCAAATGTTATTCCAAAGTTTGATTGGTCTTTCA
ATCGTATTGGATGGTAAAGAAATCATGCCTCTAACTAAGAGGCATCTTCAATCGGTTGGTTTTGGGGACG
AGGAACAAGTCGTCCCTTACAGTAAGAGAAGTTTTTCGGGATCTCGTTTATTGGTCGAGTACCTTCATTT
TCCAGAAAAATTCATGTTCTTTGACTTGATCGAGCTCGGCTTAGATAAGTTAGAGATTCAAGGGCAGGTC
GAGATTTGCTTTTACTTCGATACAAGCGATGACTGGCTACCAAAGCAAGTAGACGAGGAAAGTGTCATGG
TTGGCTGTGTTCCCATTGTAAATCTGTTCAAATCAACCATGGAACCTAAACGTCTCCTTCCAACAGAGTA
CGAGTATCAATTATCTCCTCAGTACCAAGATGCAGAGAGTAATGAAGTTGTCTCGATTTCTGATGTTACC
TTGAGAAACTGGAACAAAACTTACGAGCACTTACCCTGCTACCATTCAGGAGAGCACACGCACTACATGA
GCGCGAGTGAAGTGTATTGGTTAATGAGACGAGAGGATAAAAACTGGGCCGGTGGCTACGATGAGCCTGG
TCGAGAGACTTATGTTTCTTTTGTTGATAAGCAATACCAGTTGTTCAGCCCTGAAAGCAGAGATAATTGG
CTGATGTATGTGGAAGCTGAGTGTTGCAATCGTAATTTGCCACAAAAAATTCCATTTGGTGGCGGGCTAC
CAAAGGTTCAGTTACCCAATGTTGATGATAATTTTAAATCAATTAGGTGCTTAACGTCTCTCTCCGAAAC
GCTTAGACCAGAGATGGATGAAAGCACACGATGGCAGCTTACCAAGCTATTAACATTGAACCATTTTACT
GAAGCTGACGGCTTAGCAACGTTAAAACAAACATTGAACTTGTATGCATTTGCAGGCACTGCCGAAACAA
AAGCCGTTATAGATGCTCTAGTCAAGCTAGAGTTTGAACATACAACCGGTAGGGTTAGTCAGAAAGGAAA
AGTTGGTTTTGCACATGGAGTAAAGCTGGTTCTAACAGTATCCGATCAGATACTGCCAAAAGAGCAGATC
TTTTTATTGGGTAGCGTGTTATCTGTTTACTTTGCTCAATATGCGGAGATTAACGTGTTTACGCAGTTAG
AGATTAAGTTGAAATCAACCAGCAGCTCCTTTCACGTATGGCCTGCGCTGACAGGTGATAAGGTGTTGTT
ATGA