SecReT6
Protein ID: 28900887
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1032
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1088062..1088859 [-]
Producthypothetical protein
NoteTagJ
UniProt IDQ87HD3
KEGG IDvpa:VPA1032
PDB ID1ZBP
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.90E-40, Aligned region: 138..259
TPR_19 [PF14559], Evalue: 6.20E-05, Aligned region: 7..63
TPR_11 [PF13414], Evalue: 0.00025, Aligned region: 7..62
TPR_14 [PF13428], Evalue: 0.0026, Aligned region: 8..34
TPR_14 [PF13428], Evalue: 0.0026, Aligned region: 41..66
TPR_14 [PF13428], Evalue: 0.0026, Aligned region: 71..89
Protein Sequence: 265 a.a.     [Download]
>gi|28900887|ref|NP_800542.1| hypothetical protein VPA1032 [Vibrio parahaemolyticus RIMD 2210633]
MTQWKNALSEGQLQQALELLIEAIKASPKDASLRSSFIELLCIDGDFERADEQLMQSIKLFPEYLPGASQ
LRHLVKAAQARKDFAQGAATAKVLGENEELTKSLVSFNLSMVSQDYEQVSELALQIEELRQEKGFLANDT
SFSDVRDIDDRLGGYIELFSTAGNYFLVPIASINTLEIKSATSLLESVWRPVEFDIDGLGEGEGHMPMTY
VDSESDAQKLGRETDWKQIADKEVYLGLGLKCWLVGEMALPISDLQNLQVIKELA
 
Nucleotide Sequence: 798 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1088859-1088062 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGACTCAGTGGAAAAATGCCTTATCGGAAGGGCAGTTGCAACAAGCTTTAGAACTACTAATCGAAGCAA
TAAAGGCATCTCCCAAGGATGCCAGTTTGAGAAGCTCTTTTATTGAACTGCTTTGTATTGATGGTGATTT
TGAGCGAGCTGATGAGCAACTGATGCAGTCTATTAAACTGTTTCCTGAATATCTTCCAGGCGCTAGCCAG
TTAAGACATCTGGTTAAAGCTGCTCAAGCGCGAAAGGATTTCGCTCAAGGAGCGGCAACCGCGAAGGTAT
TGGGTGAGAACGAAGAACTAACTAAGTCATTGGTTAGCTTCAACTTATCAATGGTGAGTCAAGATTATGA
ACAAGTTTCTGAACTTGCTCTTCAAATCGAAGAACTGAGACAAGAAAAAGGCTTTTTAGCTAATGATACT
TCGTTCTCAGACGTGCGGGATATTGATGATCGTTTAGGTGGTTACATTGAGCTGTTTTCTACCGCTGGCA
ACTACTTCCTCGTCCCTATTGCTAGCATCAACACTTTAGAAATCAAATCTGCTACCTCTTTGCTAGAAAG
TGTTTGGCGCCCCGTTGAGTTTGACATTGACGGTTTAGGTGAAGGTGAAGGCCATATGCCGATGACTTAC
GTGGATTCAGAAAGTGATGCTCAGAAACTAGGTCGTGAAACGGACTGGAAACAAATAGCTGACAAAGAAG
TTTACTTAGGTTTAGGTCTGAAGTGTTGGCTTGTCGGTGAAATGGCGCTGCCGATTTCTGACTTACAAAA
TCTACAAGTAATAAAAGAGTTGGCGTAA