SecReT6
Protein ID: 28900888
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1033
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1088870..1090390 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ87HD2
KEGG IDvpa:VPA1033
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.30E-163, Aligned region: 69..500
Protein Sequence: 506 a.a.     [Download]
>gi|28900888|ref|NP_800543.1| hypothetical protein VPA1033 [Vibrio parahaemolyticus RIMD 2210633]
MVVMTKIDALNFLDPEELTHEFTPMGLAEFDSHWLTQFVECSDSILAARIWLEGTQSKDFASFRHSIVST
INTIDTLLQKQLNEIIHHPDFQKLECSWVGVRYLCEQVDKPSSDSVKIKVLSATWNEVSKDALKAIEFDQ
SALFKLLYQNEYGMAGGEPFGVVVGDYQLRYDPRTNYFDRDISVLSKISQSAAAAFSPFVMSASPEIFGV
NTFAELSSTRDVAAQFEQIDYVKWRQLRDNDDTKFIGLTAPNVLFRQPYKSDGSRNDQFEFQENIDDSNN
DLLWGSGAFCFAAVSIRAFQEHGWFTHMRGIKQGDYSQGIIVAPTRNKTRINGKNDRDRCPLNLKVSERK
EQELSDCGFIPISPVPETDMVGMTSNVSLYKPKLYEEKHVATNAKLTSMLQYTMCVSRIAHYVKVMGRDK
IGGYQDAASLEREFQTWLHQYTTASDEASDELRAKYPLNEAKIKVREKRDTPGHFYSVIHLRPHFQLDQM
VSSIKLITELSPEHLV
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1090390-1088870 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGGTAGTTATGACGAAAATAGATGCATTGAACTTTCTAGACCCAGAGGAACTCACACACGAGTTTACAC
CGATGGGCCTGGCTGAGTTTGACAGTCATTGGTTGACTCAATTTGTTGAATGTTCAGATTCAATACTTGC
GGCACGAATTTGGTTGGAAGGCACGCAATCTAAAGATTTTGCGAGTTTTCGCCATAGCATTGTGAGCACG
ATTAATACCATTGACACACTATTACAGAAGCAGCTCAATGAGATCATTCATCATCCAGATTTTCAGAAAT
TAGAGTGCAGTTGGGTAGGCGTTCGATATTTATGTGAACAAGTTGATAAACCATCGTCTGACTCCGTAAA
AATTAAAGTTCTATCTGCAACATGGAATGAAGTAAGTAAAGATGCGCTCAAGGCTATCGAGTTCGATCAG
TCTGCCTTGTTTAAATTGCTCTATCAAAATGAATATGGAATGGCCGGAGGAGAACCCTTTGGTGTGGTTG
TTGGTGATTATCAATTACGTTATGACCCGAGAACAAATTATTTTGATAGAGATATCTCTGTGCTAAGCAA
GATATCTCAGTCTGCTGCTGCGGCATTTAGTCCATTTGTAATGTCTGCGTCTCCTGAAATATTCGGTGTG
AACACATTTGCCGAACTTTCGTCGACTCGAGACGTTGCGGCACAATTTGAACAAATTGATTATGTCAAAT
GGAGACAGTTGCGAGATAACGATGATACCAAGTTTATTGGCTTAACCGCTCCTAACGTGCTTTTTCGACA
ACCCTACAAAAGTGATGGTTCTCGAAACGATCAATTTGAATTTCAAGAGAATATTGACGATTCAAATAAC
GATTTATTGTGGGGAAGTGGAGCCTTCTGTTTTGCTGCTGTTTCGATTAGAGCATTCCAAGAGCACGGTT
GGTTTACTCACATGCGAGGAATAAAACAGGGGGATTATAGTCAAGGCATTATTGTTGCTCCTACAAGAAA
CAAAACGCGCATTAATGGCAAAAATGACAGAGATAGATGCCCTTTAAATCTAAAAGTCTCTGAGCGTAAA
GAGCAAGAACTGTCTGATTGTGGGTTCATTCCGATTTCACCAGTTCCTGAAACAGACATGGTCGGCATGA
CTTCCAATGTTTCGTTGTATAAGCCAAAACTGTACGAAGAGAAGCATGTTGCGACTAATGCAAAACTCAC
CTCAATGCTCCAATACACGATGTGTGTATCGCGTATAGCACACTACGTCAAAGTTATGGGGCGAGACAAG
ATAGGTGGCTATCAGGACGCGGCATCGCTCGAGAGGGAGTTTCAGACTTGGTTACATCAATATACAACGG
CTTCAGACGAAGCTTCGGATGAACTCAGAGCTAAGTACCCATTGAACGAAGCGAAGATCAAAGTTAGAGA
GAAACGCGATACGCCAGGGCACTTCTACTCGGTGATACATTTACGCCCTCATTTTCAGCTCGACCAAATG
GTCTCAAGTATCAAATTAATTACGGAATTATCACCAGAACATTTGGTGTAA