SecReT6
Protein ID: 28900889
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1034
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1090437..1091930 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ87HD1
KEGG IDvpa:VPA1034
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.30E-184, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|28900889|ref|NP_800544.1| hypothetical protein VPA1034 [Vibrio parahaemolyticus RIMD 2210633]
MTTQVEKQLDPTVGEQTTSFLEQAIGATKQTEASRAEELIKTLTEEAMKGTVSWNKNLTVTFREAINLLD
RQISEQLSEVMHHPELQKLEGSWRGLNYLVMNSETSSTLKIRMISITKKELHKDLSKAVEFDQSQIFKKV
YESEFGSAGGEPYGALIGDYEFTNHPEDIESLRLMSNVAASGFSPFLSAASPALFGFDEWTELSKPRDLD
KVFESLEYAQWRSFRESADSRFVSLTMPKVLARLPYGQATSPVEAFGFEEFDVDPVSGIAVNADHNDYCW
MNSSYVLGVKLTDAFSKYGFCTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRREAELGKLG
FLPLCHYKNTNYAVFFGAQTCQKPANHESPEVAANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVKEIPGSPGSYNAVAWLKPWLQMEELTTSLRLVA
KIPQSGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1091930-1090437 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGACGACTCAAGTTGAAAAACAACTCGATCCTACGGTGGGTGAACAAACCACTTCATTTCTTGAACAGG
CTATTGGTGCGACGAAACAAACAGAAGCATCGAGAGCAGAAGAGCTGATCAAGACACTGACTGAAGAAGC
GATGAAGGGGACGGTTTCTTGGAATAAAAACCTAACCGTAACTTTCCGTGAAGCGATTAATTTGCTTGAT
AGACAGATTTCAGAGCAGCTTTCTGAAGTTATGCACCATCCTGAGCTACAAAAGTTAGAAGGCTCATGGC
GTGGGCTGAATTACTTAGTCATGAATTCTGAGACAAGTTCTACGCTGAAAATTCGCATGATCAGCATCAC
GAAGAAAGAGCTTCATAAAGACTTAAGTAAAGCGGTTGAATTCGATCAAAGTCAAATCTTTAAAAAAGTG
TACGAATCTGAATTTGGTAGCGCTGGTGGTGAACCGTATGGTGCTTTAATTGGTGACTACGAGTTTACAA
ACCATCCAGAAGATATTGAGTCTTTGCGTTTAATGTCGAATGTTGCTGCTTCGGGTTTCTCACCATTCTT
GTCTGCTGCTTCTCCTGCGCTATTTGGTTTTGATGAGTGGACAGAACTATCTAAACCGCGCGATTTAGAT
AAAGTCTTTGAGTCGTTGGAATATGCGCAATGGCGCTCTTTCCGTGAAAGTGCAGATTCTCGTTTTGTAA
GCTTAACGATGCCTAAAGTATTAGCTCGCTTACCATACGGCCAAGCTACCTCTCCTGTAGAAGCGTTTGG
CTTTGAAGAGTTTGATGTGGATCCTGTGTCGGGTATCGCCGTTAATGCTGATCACAATGATTATTGTTGG
ATGAACTCATCGTACGTGCTTGGCGTCAAACTGACGGATGCATTTTCTAAGTATGGTTTCTGTACTGCTA
TTCGTGGCGCAGAGGGTGGTGGGCGAGTTGATAACCTACCAACACACTTCTTCATGAGTGATGATGGTGA
CCCAGATATGAAGTGCCCAACGGAAATTGGCATTACAGACCGCCGTGAAGCGGAATTGGGTAAACTGGGT
TTCTTACCATTGTGTCACTACAAAAATACGAACTATGCCGTGTTCTTTGGTGCTCAAACTTGTCAAAAAC
CAGCAAATCATGAATCTCCAGAAGTGGCAGCAAACGCGGCAATTTCAGCAAGACTTCCTTACATGATGGC
AACCTCTCGTTTTGCACATTATTTGAAAGTAATGGCTCGAGACAAGATCGGTAGCTTTATGGAAGCAGAA
GACGTTGAATCTTGGTTGAACCGTTGGATTCTTGGCTATGTGAACGCTTCTGAAGGTGGCGGTCAAGAAA
TTCGTGCGAAATACCCTCTTGCCGACGCTCGCGTACAAGTTAAGGAAATTCCAGGTTCTCCTGGTTCTTA
CAACGCGGTTGCTTGGCTCAAGCCATGGCTTCAAATGGAAGAGCTAACCACGTCTTTAAGACTCGTTGCT
AAAATTCCTCAGTCGGGTGGCTAA