SecReT6
Protein ID: 28900890
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1035
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1091930..1092460 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ87HD0
KEGG IDvpa:VPA1035
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.50E-62, Aligned region: 8..162
Protein Sequence: 176 a.a.     [Download]
>gi|28900890|ref|NP_800545.1| hypothetical protein VPA1035 [Vibrio parahaemolyticus RIMD 2210633]
MTSIHSKLSRVRKPRVHITYDVETEGTTLKKELPFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDV
LKKMSPSVKFKVANKLANDDSEFAVELSFKSMQDFEPAAIVNQVEPLRQLMETRNKLRDLMTKVDRSEEL
ENILEEVLNNTDNLAKLAGELDLGKKAPSESTEGAE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1092460-1091930 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGACGAGTATCCACTCGAAACTTTCACGAGTACGGAAGCCTCGTGTTCACATTACCTACGATGTTGAAA
CCGAAGGAACAACTTTGAAAAAAGAGCTTCCTTTTGTGGTGGGTGTTATGGGCGACTTTGCAGGCCAAAA
TACCGAAGCATTGAAACCATTAAAGGATCGCCGTTTCATTCAAATCGATCGTGATAACTTCGATGATGTA
CTTAAAAAGATGAGTCCATCGGTTAAGTTCAAAGTCGCAAACAAGTTAGCAAATGACGATTCTGAATTTG
CGGTTGAACTGAGCTTTAAATCGATGCAAGACTTTGAACCAGCAGCGATTGTCAATCAAGTAGAACCATT
GCGTCAGCTGATGGAAACTCGTAACAAACTGCGAGACTTGATGACTAAAGTCGACCGTTCGGAAGAACTT
GAAAACATCCTAGAAGAAGTTCTCAACAATACAGACAATTTGGCAAAACTAGCTGGTGAGCTAGATCTTG
GCAAAAAAGCGCCATCAGAAAGTACTGAGGGAGCAGAATAA