SecReT6
Protein ID: 28900891
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1036
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1092476..1093597 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ87HC9
KEGG IDvpa:VPA1036
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.90E-20, Aligned region: 67..127
Protein Sequence: 373 a.a.     [Download]
>gi|28900891|ref|NP_800546.1| hypothetical protein VPA1036 [Vibrio parahaemolyticus RIMD 2210633]
MSNTMFDWYEQVLAPISEDNPTGIDPREDVSPQSAYYRLKDQRMVARNAERNAIIEEESIHTHNNLWRVF
VEEVPEVLATQSKDFEFVAWLIEALTRLYGFRGMGVGYKIASAFVESYWDELHPMPDEDGIETRISAITG
LNGIDSEGTLIFPLASIPLTDMGVEQAYAYWEYQQAIELERLDEDKRRARVDQGAIELSRITDTVKSTSD
EFYQSLIADLEFATGAFNEFSQRLDDAVGDVTPSSYISKRIESIHAALKHLLGNRFKDKAEVSISDENGD
EELEEASQQAVTHNSSALLVTNMQSREQAIQQLQHVADFFRESEPHSPVSYSIEQIIRWCGMPLPELLAE
LISDGDAKRSYFRLVGIAEQNEN
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1093597-1092476 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGAGTAACACGATGTTTGATTGGTATGAGCAAGTCCTTGCACCAATTTCGGAAGACAATCCGACTGGCA
TTGATCCAAGAGAGGATGTCTCTCCTCAGTCTGCTTATTATCGACTTAAAGATCAGCGAATGGTGGCAAG
AAACGCAGAGCGAAACGCCATCATCGAAGAAGAGAGTATTCATACACATAACAACTTATGGCGCGTATTT
GTTGAAGAAGTACCAGAAGTTCTCGCGACACAATCAAAAGATTTTGAGTTTGTTGCCTGGCTAATAGAAG
CATTAACTCGGCTTTATGGTTTTAGAGGCATGGGCGTAGGCTACAAAATTGCTAGCGCGTTTGTTGAGTC
ATATTGGGATGAGCTGCACCCAATGCCTGATGAAGACGGCATAGAAACGCGGATTTCTGCCATCACCGGA
CTTAATGGTATTGATAGTGAGGGAACGCTGATCTTTCCTCTTGCCTCTATTCCATTGACGGATATGGGTG
TAGAGCAAGCTTATGCATATTGGGAATACCAACAAGCCATTGAACTCGAGCGCTTGGATGAAGACAAGCG
AAGAGCGCGAGTAGATCAAGGCGCAATTGAATTGTCGCGTATCACTGACACGGTGAAATCAACTTCAGAT
GAGTTTTACCAGTCTCTGATTGCCGATCTCGAGTTCGCTACAGGTGCTTTTAATGAGTTCAGTCAGCGAC
TTGATGACGCTGTAGGGGATGTAACGCCTAGCTCATATATTTCAAAAAGAATTGAATCAATACACGCGGC
ACTTAAGCACTTGTTGGGTAATCGTTTTAAGGATAAGGCTGAGGTCTCCATTTCTGACGAAAATGGTGAT
GAAGAGTTAGAAGAAGCAAGTCAACAAGCAGTTACTCACAACTCATCTGCGTTATTAGTTACAAACATGC
AATCTCGAGAACAAGCTATTCAACAGTTGCAACATGTGGCGGACTTTTTTAGAGAAAGCGAGCCTCACTC
ACCAGTTTCTTACTCCATCGAACAAATTATTCGTTGGTGTGGAATGCCTCTGCCTGAATTACTGGCGGAA
CTAATCTCCGACGGAGACGCAAAACGAAGCTACTTCCGTTTGGTTGGCATAGCAGAACAAAATGAAAATT
AA