SecReT6
Protein ID: 28900895
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1040
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1098604..1099905 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ87HC5
KEGG IDvpa:VPA1040
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.80E-62, Aligned region: 52..257
OmpA [PF00691], Evalue: 9.20E-14, Aligned region: 254..273
OmpA [PF00691], Evalue: 9.20E-14, Aligned region: 325..423
Protein Sequence: 433 a.a.     [Download]
>gi|28900895|ref|NP_800550.1| hypothetical protein VPA1040 [Vibrio parahaemolyticus RIMD 2210633]
MVSMEQTIVKPTPGGRAAVSKAQPQRSADSTVVISKNPELVNNDSVVAYGDNPLLAEANGLLSIIGQIRA
TATHSDPLFLKETLAQKLRDYENRLRQHDVDLETIDTARYCLCCSLDEAVLNTNWGSQSFWTHDSLLSSF
YASSQGGEAFFKHLDSCLAHPESHLDLLELMYVCLSLGFIGQYRLEKNGLEAHRRLRKQVVSVLKSHGRG
VQQELSNKVEQHILAGAQVSERAPLWVVCSVTSALLVCIFMYFSYELNKASNQTFAQLVNLIQPTPAVSN
PMVESKSAPIAERISMYLATEIGKDLVTVEALQDRVRISLKAQDLFESGSASVVAYIQPVISKVARTLEA
TQGKIIITGHTDDRPIFTSKYPSNWHLSLARATSLSEQLISNSALKGRVIPEGLGDARPLVENDSEKNRA
MNRRIEIDLIVGN
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1099905-1098604 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
GTGGTAAGTATGGAACAGACGATAGTAAAACCTACTCCTGGCGGAAGAGCGGCTGTATCTAAAGCTCAGC
CTCAAAGATCAGCAGACAGTACTGTTGTGATATCCAAAAACCCTGAGTTGGTTAATAACGATTCAGTTGT
TGCTTATGGAGATAATCCACTATTGGCAGAAGCTAATGGTCTACTTTCGATTATTGGACAAATCAGAGCA
ACAGCTACTCATTCCGATCCTTTGTTTCTTAAAGAAACGCTCGCGCAAAAACTTAGGGATTATGAGAATC
GTCTGCGTCAACATGATGTTGACTTGGAAACCATTGATACCGCACGTTATTGTCTGTGTTGTTCTTTAGA
CGAAGCAGTATTGAATACCAATTGGGGAAGTCAATCGTTTTGGACACATGATTCTCTGTTGAGTTCTTTT
TACGCGAGCAGCCAAGGTGGAGAGGCTTTTTTTAAGCATCTAGATAGCTGTTTGGCTCATCCGGAATCCC
ACCTAGATTTACTAGAGCTAATGTACGTATGCTTATCTTTGGGTTTTATAGGTCAGTATCGTTTAGAAAA
AAATGGGCTTGAAGCTCACCGTAGATTGAGAAAACAAGTTGTATCAGTGCTTAAGTCACATGGTCGCGGA
GTACAGCAAGAGCTTAGTAACAAAGTAGAACAACATATATTGGCAGGTGCTCAGGTTTCGGAACGTGCTC
CTCTATGGGTGGTTTGTTCGGTAACTTCCGCACTGCTTGTTTGTATTTTTATGTACTTCAGCTACGAGTT
GAACAAAGCTTCCAACCAAACTTTTGCTCAATTGGTAAACCTGATTCAACCAACCCCAGCAGTTAGTAAT
CCTATGGTTGAGTCAAAGTCAGCACCTATTGCCGAAAGAATATCTATGTATTTGGCAACGGAGATTGGCA
AGGATCTTGTCACTGTGGAAGCGTTGCAAGATAGAGTTCGTATTTCTCTTAAAGCTCAAGACCTATTTGA
ATCTGGTAGTGCGAGCGTTGTGGCTTACATACAGCCAGTTATTTCTAAAGTTGCACGCACCTTAGAAGCG
ACACAAGGGAAGATCATAATTACCGGGCATACCGATGACCGTCCGATATTTACCAGCAAGTACCCATCCA
ATTGGCACTTGTCTTTAGCTCGGGCAACTTCTCTTTCCGAACAGTTAATCTCCAACAGTGCACTTAAAGG
AAGAGTGATTCCTGAAGGGTTGGGTGATGCGAGACCTTTGGTAGAAAATGATAGTGAAAAGAACCGAGCA
ATGAATCGTCGAATTGAAATCGATCTTATTGTGGGCAACTAA