SecReT6
Protein ID: 28900896
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1041
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1099908..1101233 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ87HC4
KEGG IDvpa:VPA1041
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.50E-130, Aligned region: 19..439
Protein Sequence: 441 a.a.     [Download]
>gi|28900896|ref|NP_800551.1| hypothetical protein VPA1041 [Vibrio parahaemolyticus RIMD 2210633]
MMQYSKTAWCEGMFLRPQHFQQHERAISNEYKGLHSLGGSYTWGVWNCRVKEHALKTGLIELDNLQAILP
DMTLIDFSATTSFLSPLKVKKGTENTLVKVIVPLSKVSSKMIADPSETTVSRYLLQDLDVIDNLTGQDEE
TIQVASLNIELKSSNEQLTGYIELPILKIKEVSTEGEVILDDSYVPPLLNLLNDKVMTGYLRNAMAMTKI
RADVIAQRLVKGKAASASAVDFIMLQMLNRYEAILKHFSELEKVHPLELATTFKGYIGELATFSHTTKRL
PNLKAYDHLEVASVFAELNQVLSQYLSVVLDQTASKLPLEVRQYGIQVTPLPDKRLLESCQFVLAIKADT
TTDEIRRLVPAQLKLGPAEQIRDLINNQINGINVAPLSVVPRQIPYQTGYVYFEVVKKGPFWMRLKDSGG
IALHLSGHFPNPDIELWSINQ
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1101233-1099908 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGATGCAATACTCCAAGACGGCTTGGTGCGAGGGGATGTTTCTGCGTCCCCAGCATTTTCAACAGCACG
AACGCGCAATATCTAATGAATATAAAGGCTTACACAGTTTAGGTGGCTCATATACGTGGGGCGTTTGGAA
TTGCCGTGTAAAAGAACATGCCTTAAAAACAGGCTTGATTGAACTTGATAATCTTCAAGCAATTCTTCCT
GATATGACGCTGATAGACTTTTCAGCAACAACAAGTTTTCTGTCTCCTTTAAAGGTAAAAAAAGGGACGG
AAAATACCTTAGTGAAGGTGATCGTTCCACTCTCAAAAGTCAGCAGTAAAATGATCGCGGATCCAAGTGA
AACAACGGTTTCTCGGTATTTACTTCAAGATCTAGACGTTATTGATAACCTGACGGGCCAAGATGAAGAA
ACGATTCAAGTGGCCTCATTAAATATCGAGCTGAAATCAAGCAATGAGCAGTTAACAGGTTATATAGAGC
TACCAATCCTTAAGATTAAAGAAGTTTCTACGGAAGGAGAGGTCATTCTTGATGACTCTTACGTACCGCC
ACTTCTAAACTTGTTAAATGACAAGGTGATGACGGGGTATCTACGTAATGCAATGGCAATGACCAAGATA
CGCGCAGATGTTATCGCTCAACGACTTGTTAAAGGAAAAGCGGCTTCAGCATCTGCGGTAGATTTCATAA
TGCTGCAAATGTTGAATCGATATGAAGCCATATTGAAGCATTTTAGTGAGCTGGAGAAAGTACATCCCTT
AGAGCTTGCGACAACCTTTAAAGGCTATATAGGCGAGTTGGCAACGTTTTCTCACACCACCAAGCGCTTA
CCTAATCTCAAAGCTTACGATCACCTTGAAGTTGCAAGTGTGTTTGCTGAACTTAATCAAGTCCTTAGTC
AGTACTTGAGTGTCGTTCTTGATCAGACTGCAAGTAAGTTGCCACTAGAAGTACGCCAGTACGGTATTCA
AGTGACACCACTTCCAGATAAGCGACTATTGGAATCATGTCAGTTTGTATTGGCGATTAAAGCGGACACA
ACAACGGATGAGATTAGACGCTTAGTCCCTGCGCAATTGAAGCTTGGTCCGGCAGAACAGATTAGAGATC
TAATCAACAACCAGATTAATGGAATTAACGTAGCTCCTTTAAGTGTCGTGCCGCGACAGATTCCATATCA
AACCGGGTATGTTTATTTTGAGGTCGTTAAGAAGGGGCCATTCTGGATGCGACTTAAAGACAGCGGTGGT
ATTGCACTGCATTTATCTGGTCATTTCCCAAATCCGGACATAGAGCTTTGGAGCATTAATCAATAA