SecReT6
Protein ID: 28900897
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1042
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1101255..1101710 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ87HC3
KEGG IDvpa:VPA1042
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-40, Aligned region: 14..147
Protein Sequence: 151 a.a.     [Download]
>gi|28900897|ref|NP_800552.1| hypothetical protein VPA1042 [Vibrio parahaemolyticus RIMD 2210633]
MKQIYKSFLLFIFLVLMGCSAANLVVDPYADLEITANHNINPDSNGRPSPVVVYVFELTSNTLFESQDFF
SIYEEHEKVLGPDLVNKYEISLTPGQKEIYQASMSPKTEYLGIVAAFRDIENSNWRQVIKVDKTGYNTYQ
ISLEDLSLVVQ
 
Nucleotide Sequence: 456 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1101710-1101255 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
GTGAAACAAATTTATAAATCATTTTTGCTGTTTATATTTTTAGTATTAATGGGATGCTCCGCCGCTAATT
TAGTGGTCGACCCATATGCGGATTTAGAAATAACGGCAAATCATAATATCAACCCTGACTCGAATGGAAG
ACCATCACCAGTTGTTGTATATGTATTTGAGCTTACATCAAATACACTGTTTGAGAGCCAAGATTTTTTC
TCTATTTATGAGGAGCATGAAAAAGTACTCGGTCCAGACTTGGTGAATAAATATGAAATATCTTTGACAC
CAGGCCAAAAAGAAATCTACCAAGCTAGTATGTCTCCTAAAACAGAATATTTGGGTATCGTAGCCGCGTT
TCGCGATATTGAGAATTCAAATTGGCGACAAGTCATTAAAGTAGATAAGACGGGTTACAACACTTATCAA
ATCTCGTTAGAAGATCTGTCTTTGGTCGTACAATAA