SecReT6
Protein ID: 28900898
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1043
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1101720..1102916 [-]
Producthypothetical protein
NoteFha
UniProt IDQ87HC2, Q87HC2
KEGG IDvpa:VPA1043
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.10E-16, Aligned region: 32..101
FHA [PF00498], Evalue: 3.10E-16, Aligned region: 376..386
FHA [PF00498], Evalue: 3.10E-16, Aligned region: 32..101
FHA [PF00498], Evalue: 3.10E-16, Aligned region: 376..386
Protein Sequence: 398 a.a.     [Download]
>gi|28900898|ref|NP_800553.1| hypothetical protein VPA1043 [Vibrio parahaemolyticus RIMD 2210633]
MKLVLTITSFHKFTPEIESEFVFESSDEHAKVTFGRSEQCDWTLPDPERVISGTHGELIKFGDKYLIKDL
STNGTFVNNAVTPIGQGNELALSHGDTVALGDYQIQISISDISEDRTEHQFTSNPEVKTPVGFEQHVESI
PEMEDFGLSAAELMDESVPSDFQLDIGLVDDFLEIPSHETEVPQPKVASMQPDTNAKSQKPTVHRGELEA
FIYGMGIDPNMVPSQNREQWFEQLGQSFSLMLIGLMETLHNRAVFKQTNRVNHTAFRKSENNPLKFSANL
EDAIHNLYNRQTSSFLKPNAAIKEAFNDIENHEQALMQGVAGTVSSVMSLVEPNTIYSDALAKDNVINKV
IPARKYAQSWKRFEGIHSQLTDELVNKESPFYLEDFAKHYELALKNKG
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1102916-1101720 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGAAATTGGTATTGACCATAACGAGTTTCCACAAATTTACTCCGGAAATAGAGAGTGAGTTTGTGTTTG
AATCAAGTGATGAGCATGCAAAGGTAACCTTCGGACGCTCAGAACAATGTGACTGGACGTTACCAGACCC
TGAGAGAGTTATTTCTGGGACTCACGGCGAATTGATTAAATTTGGCGATAAATATCTAATTAAAGATTTA
TCAACAAATGGCACATTTGTTAATAATGCAGTTACTCCAATCGGCCAAGGGAATGAGCTTGCTTTGTCCC
ATGGTGACACTGTTGCTTTAGGCGATTATCAAATACAAATTAGTATTAGTGATATCTCTGAAGATAGGAC
AGAGCATCAATTTACATCTAACCCAGAGGTTAAGACGCCAGTTGGATTCGAACAGCACGTAGAATCGATT
CCAGAGATGGAAGATTTTGGTTTAAGCGCTGCCGAGTTGATGGATGAAAGTGTCCCATCAGATTTTCAGT
TAGACATTGGTCTAGTAGATGATTTTCTAGAAATTCCGAGTCACGAAACTGAAGTGCCACAACCTAAAGT
TGCATCAATGCAGCCTGATACCAACGCTAAAAGTCAAAAACCTACAGTGCATCGAGGTGAACTGGAAGCC
TTCATTTATGGCATGGGGATCGACCCCAATATGGTACCAAGCCAAAATCGAGAGCAGTGGTTTGAACAAT
TAGGTCAGTCGTTTTCTCTCATGCTTATTGGGCTAATGGAGACTCTTCACAATCGGGCTGTATTTAAACA
AACCAATCGCGTCAACCATACTGCATTTAGAAAGTCTGAAAATAATCCACTTAAGTTTTCAGCAAATTTG
GAAGATGCAATACACAATTTGTATAACCGTCAAACGTCAAGTTTTTTAAAGCCTAATGCCGCAATAAAAG
AAGCATTTAACGATATTGAAAATCATGAGCAGGCTTTAATGCAAGGAGTAGCGGGTACGGTATCGAGTGT
CATGTCTCTCGTTGAACCTAATACTATTTATTCAGATGCATTGGCTAAAGACAATGTAATTAACAAGGTT
ATTCCAGCAAGAAAATATGCTCAGAGTTGGAAGCGCTTTGAAGGTATTCATAGCCAATTAACAGATGAAC
TTGTCAATAAAGAGTCTCCATTTTATTTAGAAGATTTTGCTAAGCACTACGAATTAGCGCTCAAGAATAA
AGGTTAA