SecReT6
Protein ID: 290473344
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0261
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]268621..269139 [-]
Producthemolysin-coregulated protein Hcp
NoteTssD
UniProt IDD3UYN4
KEGG IDxbo:XBJ1_0261
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.20E-37, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|290473344|ref|YP_003466210.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MPTPCYISINGKTQGNITAGAFTAESVGNIFVQGHEDEMLVQEFDHIVTVPTDPQSGQPSGQRAHKPFRF
TVALNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFTTKLEDATIVDIDCKMPHCQDPSKAEFTQ
LIRVSLSYRKINWEHTTAGTSGSDDWRAPIVA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c269139-268621 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGCCAACTCCATGTTATATTTCCATCAATGGAAAAACTCAGGGCAATATTACTGCTGGTGCATTCACTG
CTGAATCAGTAGGTAATATTTTCGTTCAAGGTCACGAAGACGAAATGCTGGTTCAAGAATTTGACCACAT
TGTCACTGTCCCAACTGATCCACAGTCAGGTCAGCCTTCTGGCCAGCGTGCGCATAAACCATTCCGCTTC
ACCGTTGCATTGAACAAAGCCGTTCCTCTGCTTTACAACGCACTGGCTTCTGGCGAAATGTTACCTACTG
TTGAATTGAAATGGTACCGTACTTCAATCGAAGGTAAACAAGAGCATTTCTTCACGACCAAACTTGAAGA
TGCAACTATTGTTGACATTGATTGCAAAATGCCACATTGCCAAGATCCATCAAAAGCAGAATTTACTCAA
TTAATTCGTGTGTCTCTTTCTTATCGTAAGATTAACTGGGAACACACTACAGCAGGTACTTCTGGTTCTG
ATGACTGGCGTGCGCCAATTGTTGCTTAA