SecReT6
Protein ID: 290473346
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0263
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]270061..270558 [+]
Producthypothetical protein
NoteTssB
UniProt IDD3UYN6
KEGG IDxbo:XBJ1_0263
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-58, Aligned region: 8..160
Protein Sequence: 165 a.a.     [Download]
>gi|290473346|ref|YP_003466212.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MSKNSPGSVAPKERINIKYVPNTGDQTAEVELPLNLLVVGDLKGKKEDTPIEERQTVSVNKNNFNAVMNE
ANINLTFNVPNRLDEKNEEDMPVNLEIKSLSDFSPDNIAKKVPELNKLLELREALVALKGPLGNIPAFRT
RLQSLLDDESVREQLLKELEIVNKK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|290473094|ref|NC_013892.1|:270061-270558 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAGTAAGAATAGTCCAGGTAGCGTAGCTCCGAAAGAAAGAATTAATATTAAGTATGTTCCGAATACGG
GTGACCAGACCGCAGAAGTCGAATTACCGTTGAATCTTCTGGTTGTCGGTGATTTGAAAGGAAAGAAGGA
AGATACGCCAATTGAAGAACGGCAAACAGTTTCAGTCAATAAGAACAATTTCAATGCCGTAATGAATGAG
GCGAACATCAATCTGACTTTTAACGTCCCTAATCGTCTTGATGAAAAAAATGAAGAAGACATGCCTGTTA
ATCTGGAAATTAAATCACTGAGTGATTTTTCACCGGATAATATCGCAAAAAAAGTGCCTGAATTAAATAA
ACTTCTGGAACTGCGTGAGGCATTGGTTGCACTAAAAGGCCCTCTGGGAAATATCCCTGCATTTCGTACT
CGCTTGCAGTCGCTTCTGGATGATGAATCCGTGCGTGAGCAACTCCTGAAAGAACTTGAAATCGTCAATA
AAAAATAA