SecReT6
Protein ID: 290473347
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0264
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]270579..272057 [+]
Producthypothetical protein
NoteTssC
UniProt IDD3UYN7
KEGG IDxbo:XBJ1_0264
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.60E-185, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|290473347|ref|YP_003466213.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MAQHEENSTALASGATTSLLDEIMSQARITPENDGYYIAKQGIAAFISSILDTGANEEPINKLVVDKMIV
ELDKKLSEQMDEIMHAKPFQELESSWRSLKILVDRTDFRENIKINIIHATKDEMLEDFEFSPEIIQSGFY
KHVYSTGYGQFGGEPVAAVIGNYAFTNSSPDIKLMQYVSAVGAMAHSPFLSSVSPEFFGVNSFTDLPAIK
DLKSVFEGPSHTKWRALRESEDSRYLGLTAPRFLLRLPYSSVENPIKNFNYQENVSRDHEHFLWGNTAYL
MASCLTDSFAKYRWCPNIIGPQSGGTVSDLPVHLYEAMGQVQAKIPTEVLITDRREFELAEEGFITLTMR
KGSDNAAFFSANSVQKPKVFPNTREGKIAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNMWLKQYIADQENPPTDVRSRRPLRAAEIKVLDVEGDPGWYQVAMQVRPHFKYMGASFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|290473094|ref|NC_013892.1|:270579-272057 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGCTCAGCACGAAGAAAACAGCACCGCTCTTGCTTCTGGCGCAACGACCTCCCTGCTTGATGAAATTA
TGTCTCAGGCAAGAATCACACCAGAAAATGACGGCTACTATATCGCAAAACAAGGTATCGCTGCGTTTAT
CAGCAGTATTCTGGACACAGGCGCTAACGAAGAACCGATCAACAAACTCGTCGTTGATAAAATGATCGTT
GAGCTTGATAAAAAGCTGAGTGAGCAGATGGATGAAATCATGCACGCGAAGCCGTTTCAGGAGCTGGAAT
CCTCATGGCGTTCACTGAAAATTCTGGTGGATCGCACTGATTTCCGTGAAAACATCAAAATCAACATCAT
TCATGCTACTAAAGATGAAATGCTGGAAGACTTTGAGTTTTCGCCTGAAATCATTCAGTCTGGTTTCTAC
AAACACGTCTACTCTACAGGCTACGGTCAGTTCGGTGGTGAACCTGTTGCTGCCGTCATCGGTAACTATG
CATTCACCAATTCCTCACCTGACATCAAACTGATGCAATACGTCAGTGCTGTCGGTGCAATGGCTCACTC
ACCATTCCTTTCTTCCGTTTCACCTGAGTTCTTTGGTGTTAACAGTTTTACCGACCTGCCAGCCATCAAA
GATTTGAAGTCTGTCTTCGAAGGCCCTTCACATACTAAATGGCGTGCACTGCGCGAATCTGAAGATTCTC
GCTATCTGGGTCTGACAGCACCCCGTTTCCTGTTGCGTCTGCCTTATTCCAGCGTTGAAAATCCAATCAA
AAACTTCAACTATCAGGAAAATGTCAGTCGTGACCACGAGCATTTCCTGTGGGGTAACACGGCTTATCTG
ATGGCGAGTTGTCTGACGGACAGCTTTGCTAAATATCGCTGGTGTCCAAACATCATCGGTCCACAGAGCG
GCGGTACGGTGAGCGATTTGCCTGTGCATCTGTATGAGGCAATGGGTCAGGTGCAGGCTAAAATCCCAAC
TGAGGTTCTGATCACTGACCGTCGTGAATTTGAACTGGCAGAAGAAGGCTTTATTACGCTGACCATGCGT
AAAGGCAGCGATAACGCCGCATTCTTCTCTGCAAACTCAGTTCAGAAGCCAAAAGTTTTCCCGAATACCC
GTGAAGGTAAGATTGCGGAAACCAACTACAAGTTGGGTACGCAGCTTCCATACATGTTCATCATCAACCG
TCTGGCTCACTACATCAAAGTATTGCAGCGCGAACAGATCGGCTCTTGGAAAGAGCGTCAGGATCTGGAG
CGTGAACTGAATATGTGGCTGAAACAGTACATTGCTGATCAGGAAAACCCGCCAACTGATGTTCGTAGCC
GTCGTCCGCTGCGTGCAGCTGAAATCAAGGTACTGGATGTTGAAGGTGATCCAGGTTGGTATCAGGTGGC
TATGCAAGTTCGCCCACACTTTAAATATATGGGTGCAAGTTTCGAACTGTCACTGGTTGGACGTTTGGAT
AAGGAATAA