SecReT6
Protein ID: 290473348
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0265
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]272060..272500 [+]
Producthypothetical protein
NoteTssE
UniProt IDD3UYN8
KEGG IDxbo:XBJ1_0265
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-19, Aligned region: 31..122
Protein Sequence: 146 a.a.     [Download]
>gi|290473348|ref|YP_003466214.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MAALYSWNRGSSASLFERIQGKGSGSSRQSRMRSLLDSIKKHLKEVLNSRPGACQSAIDLGVIDLNDATA
TSVDFKQSIEWAIEECIRNYEPRISAVSVSAINDDSDPLLLSFHISAEILLDDINDIVEFSIQLDNNRRY
CLERTQ
 
Nucleotide Sequence: 441 bp     [Download]
>gi|290473094|ref|NC_013892.1|:272060-272500 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGCTGCGCTGTACAGTTGGAACAGGGGCAGCTCTGCCAGTCTGTTCGAGCGCATTCAAGGGAAGGGCT
CCGGCTCTTCCCGTCAGTCAAGGATGCGTTCACTGCTTGATTCTATAAAGAAGCATCTGAAGGAAGTGCT
GAATTCTCGTCCTGGTGCCTGTCAGAGTGCTATTGATCTGGGTGTTATTGATCTCAATGACGCGACGGCA
ACATCGGTGGATTTTAAGCAAAGCATCGAGTGGGCGATAGAAGAGTGCATCAGAAATTATGAACCCAGAA
TATCAGCGGTTTCCGTCAGCGCCATCAACGATGATTCAGATCCGTTGCTGTTGAGCTTTCACATCAGCGC
TGAAATCTTGTTGGATGATATCAACGATATTGTGGAATTCAGCATTCAGTTGGATAACAACCGGCGCTAT
TGCCTGGAGCGAACTCAATAA