SecReT6
Protein ID: 290473349
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0266
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]272501..274333 [+]
Producthypothetical protein
NoteTssF
UniProt IDD3UYN9
KEGG IDxbo:XBJ1_0266
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.80E-203, Aligned region: 3..610
Protein Sequence: 610 a.a.     [Download]
>gi|290473349|ref|YP_003466215.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MSFEKYFRDELNYLRQLGKEAAVERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLRAKIDDQFPELTHGL
LNMLWPNYLRPTPSMTIIEYTPDESVVTKATPVKRGTQIMSNTLSTHDDIYSNEKSGGKRDEQGRCTFTL
CRDVWLFPLSIQDISVNNSNEQGIIGLNFASKTELSLHELELDKLRFYLSGDDYTTSQLYFWLCYYFRKA
ELVVGDKVIPLPDFDFVPVGFEREDALLPYPKNAYMGYRILQEYFCFAESFLFFDVKGFPTLPEDLKTKD
FKLNLHFSQALPPEAKIRHDTFRLHCTPAINLFPMDSEAIELNGSQAEYPLKASYSLPDNYDIFSVDGVE
SWLAGENGERSRARIGERVYTPFESFNHQIDDEDERSMRYYRLRVKESPFRRGLEHFISFVRGDESDLLR
LKLKENVSISLTCTNRELPLQLRVGDINYPSIGSPTFATFRNITRPSVPLYPLLDGGLHWSLLSNMSLNY
MSLLDKDALKQVLRTYDFPSIHNRQSKRSSQKRLDAIEKIETEPTDRLFRGQPVRGLRSTLYIRQQAFSS
EGELYLFSTILSRFFSLYASVNAFHMLKVINLDNQECYEWPVQIGQHSLM
 
Nucleotide Sequence: 1833 bp     [Download]
>gi|290473094|ref|NC_013892.1|:272501-274333 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGTCATTTGAAAAATATTTCAGAGATGAGTTGAATTATCTGCGACAACTGGGGAAAGAAGCCGCAGTTG
AGCGTCCTCATCTTGCCGCATTTCTGTCTGAACAAGGTTCTGACCCCGACGTTGAGCGTTTGCTTGAAGG
TTTTGCATTCCTGACTGGCAATCTACGGGCAAAGATTGATGATCAATTCCCCGAACTGACTCATGGCCTG
CTCAATATGCTTTGGCCTAATTACCTGCGTCCGACGCCCAGTATGACTATCATCGAGTACACACCCGATG
AGAGCGTCGTGACGAAAGCGACACCGGTCAAGCGTGGCACGCAGATTATGAGTAACACGCTGTCAACTCA
TGATGATATTTATTCGAACGAAAAATCGGGTGGTAAAAGAGACGAACAAGGCCGCTGTACTTTTACGCTG
TGTCGTGATGTCTGGCTTTTCCCTCTCTCCATCCAAGACATTTCTGTCAATAACAGTAATGAGCAAGGCA
TCATCGGCCTGAATTTTGCGTCGAAAACTGAACTGAGCCTGCATGAACTGGAACTGGACAAACTGCGTTT
TTACCTGAGCGGTGATGACTATACCACTTCTCAGCTCTACTTCTGGCTCTGTTATTACTTCAGAAAAGCA
GAACTGGTGGTTGGCGATAAGGTAATCCCACTACCGGATTTTGATTTTGTGCCGGTAGGGTTTGAACGGG
AAGATGCCCTGTTGCCGTACCCCAAAAACGCTTACATGGGATATCGCATTTTGCAGGAATATTTCTGTTT
TGCGGAGAGCTTCCTGTTTTTTGATGTGAAGGGTTTCCCAACATTACCTGAAGATCTTAAGACCAAAGAT
TTCAAACTGAATTTACATTTTTCTCAGGCATTACCACCAGAAGCCAAGATTCGGCATGATACTTTCCGTC
TGCACTGTACACCAGCCATCAACCTGTTTCCGATGGACAGTGAAGCTATTGAACTCAATGGCAGCCAGGC
TGAATATCCATTGAAGGCCAGTTATAGCCTCCCCGATAACTACGATATTTTTTCCGTCGATGGCGTTGAA
AGCTGGTTGGCGGGTGAAAATGGTGAACGCAGTCGGGCACGTATCGGCGAGCGTGTCTATACACCGTTCG
AAAGTTTCAATCACCAGATTGATGACGAAGATGAACGCTCAATGCGTTATTACCGCCTTCGGGTGAAAGA
ATCGCCTTTCCGTCGGGGGCTGGAACATTTCATCTCATTTGTACGGGGAGATGAATCGGATCTGCTCAGA
CTCAAACTAAAAGAAAATGTTTCTATCAGTTTGACATGTACTAACCGTGAATTGCCGTTGCAGCTGCGTG
TTGGCGACATTAATTACCCATCCATCGGCAGCCCGACATTTGCGACATTCCGCAATATCACGCGCCCGTC
AGTGCCACTCTATCCTCTTCTGGATGGCGGTCTGCACTGGTCGCTACTGTCAAACATGTCGCTGAACTAT
ATGTCATTGCTGGATAAGGACGCGCTGAAGCAGGTACTGCGTACCTATGATTTCCCGAGTATCCATAACC
GACAGTCCAAACGGTCATCGCAGAAACGGCTTGATGCCATTGAAAAGATCGAGACAGAGCCGACAGATCG
CCTGTTTCGTGGGCAGCCCGTTCGCGGCTTGCGCTCCACGCTATATATCCGGCAACAGGCATTCAGCTCA
GAAGGCGAGCTTTATCTGTTCAGTACGATTTTGTCACGGTTTTTCTCACTGTATGCCAGCGTCAACGCTT
TTCATATGTTGAAGGTAATCAATTTAGATAATCAGGAGTGTTATGAATGGCCGGTACAGATAGGTCAACA
CTCATTGATGTAA