SecReT6
Protein ID: 290473350
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0267
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]274297..275349 [+]
Producthypothetical protein
NoteTssG
UniProt IDD3UYP0
KEGG IDxbo:XBJ1_0267
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.80E-92, Aligned region: 26..337
Protein Sequence: 350 a.a.     [Download]
>gi|290473350|ref|YP_003466216.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MAGTDRSTLIDVITEQDPATPLALDISQYNFYQLVELLNQLAVAWEKTGETDRPDRESVRFRASASLAFP
TRDVISLSQTRRGYFELEVSFMGLHGSQSPMPGYYLDSLAWEEAQNENRLTDFLNLFNHRLITLLHQIWR
KYRYYVCFKKGGEDHFSQRMFSLVGLGSDVNRRMLNINHSKMLAYAGLLASPGRSPEVICSLVSHCFDLQ
DVTLHGWQFRKVTIPLDQQNRLGSERKGQVIGDSKLSMLGQNFTIGSWVGDYSGKFLLSINNLTRDRFLS
FLPDGKNYAPLVMFISFVMRSQFAWELRLGLAENQVSGMVLGAQQNNHLGWTSFLGEPEKKPFVTISVME
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|290473094|ref|NC_013892.1|:274297-275349 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGCCGGTACAGATAGGTCAACACTCATTGATGTAATCACTGAGCAAGATCCTGCCACACCCTTGGCAT
TGGACATTTCACAGTACAACTTTTATCAGTTGGTTGAGCTGCTCAATCAGCTGGCGGTAGCGTGGGAAAA
AACGGGAGAGACCGATCGTCCTGATCGTGAGTCTGTTCGTTTCAGAGCCAGTGCCAGTCTGGCATTTCCG
ACTCGTGACGTGATCTCACTCTCGCAGACCAGACGGGGTTATTTTGAGCTGGAAGTCTCCTTTATGGGGC
TACACGGCAGTCAGTCCCCGATGCCAGGTTACTATCTCGATTCGCTGGCTTGGGAAGAAGCGCAGAACGA
AAACCGACTGACGGATTTTCTCAACCTGTTTAACCATCGCTTAATCACGCTTCTGCATCAGATCTGGCGG
AAATACCGCTATTACGTCTGCTTTAAGAAGGGGGGAGAAGATCATTTTTCTCAGCGCATGTTTTCCCTTG
TGGGTCTGGGGAGCGATGTCAACCGCCGGATGCTGAACATTAATCACAGCAAAATGCTGGCCTATGCAGG
GCTGCTGGCAAGCCCCGGCCGCTCGCCGGAAGTGATATGCAGTTTGGTTTCCCACTGTTTTGATTTACAG
GATGTCACCCTGCACGGCTGGCAATTCAGAAAGGTCACTATTCCCCTTGATCAGCAGAACCGCTTGGGAA
GCGAAAGGAAAGGACAGGTAATCGGTGACTCTAAACTGTCCATGCTGGGGCAGAATTTCACCATTGGTTC
ATGGGTCGGCGATTACAGCGGGAAGTTCCTTCTCAGCATCAATAATCTGACTCGTGATCGGTTCCTGTCT
TTCCTGCCGGATGGAAAGAATTATGCCCCATTGGTGATGTTTATTTCTTTCGTCATGCGCAGTCAATTTG
CATGGGAATTGCGTCTTGGTCTGGCAGAAAATCAGGTCAGCGGCATGGTATTGGGGGCGCAGCAGAATAA
CCATCTGGGGTGGACTAGTTTTCTCGGCGAACCGGAAAAGAAACCTTTTGTCACAATTTCAGTTATGGAA
TAA