SecReT6
Protein ID: 290473351
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0268
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]275355..276650 [+]
Producthypothetical protein
NoteFha
UniProt IDD3UYP1
KEGG IDxbo:XBJ1_0268
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 431 a.a.     [Download]
>gi|290473351|ref|YP_003466217.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MEKQQPTLSLRVLNSEQLESGRSASCLFSAQGGTVGSSESHLWSVQDQQGNIHPSQFSVQWRDGAFCLQV
LAEPVQINNAALTPQSSLIRLQQGDQIKAGNLSIKIHISFSDADRVDPSTVSPESLVSSYSNPLDAMMEG
AVVQKAVFADDNSIAPTIQHSFSDDPLRVLDSESLTTLKQQVEADDTEQLLPPDHFQSPPFANPISDNRG
SVMDQEFLDLPGITSERQYADMDVDHVAITPLMRGLDAQLPLHDSQQANDFLQEMGKTMKAAIEGLLALQ
REQHGLRDKQLRPIEDNPLRLNMDYDTTMQVMFSDQKSPVHLSAPAAVSESLHNLQLHYQANREAISAAL
DTMLEAFSPDQLLRRFSHYRRSNEVRNKDAAWAWEMYTNYYRELASSRQQGFEKLFREVYEQAYDRALRQ
GLEDSSNETFR
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|290473094|ref|NC_013892.1|:275355-276650 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGAAAAACAACAACCAACGCTTTCATTGCGGGTTCTCAACAGTGAGCAACTGGAAAGTGGCAGATCCG
CCAGTTGCCTGTTTTCGGCACAGGGCGGTACGGTCGGTAGCAGTGAAAGTCACCTGTGGTCTGTTCAGGA
TCAGCAGGGAAATATTCATCCATCACAATTCTCCGTGCAGTGGCGGGATGGTGCATTCTGCCTGCAAGTA
CTCGCAGAACCTGTGCAGATCAACAATGCCGCATTAACGCCTCAGTCAAGTCTGATCCGTTTGCAGCAGG
GAGATCAGATTAAGGCGGGTAATCTGTCTATTAAGATCCACATCAGTTTTTCTGATGCAGATCGTGTTGA
TCCTTCGACGGTATCACCTGAATCCTTGGTATCGAGTTACAGCAACCCGCTGGATGCCATGATGGAAGGC
GCAGTAGTACAAAAAGCCGTGTTTGCCGACGATAACAGTATTGCTCCAACGATCCAGCATAGTTTCAGCG
ATGACCCGCTCAGGGTACTCGATAGCGAAAGCCTGACCACGCTGAAGCAGCAGGTTGAAGCTGATGATAC
TGAGCAGCTTTTGCCGCCGGATCATTTCCAATCACCCCCATTTGCTAACCCTATTTCTGATAACCGAGGC
AGTGTTATGGATCAGGAGTTCCTTGATTTACCGGGTATCACTTCCGAGCGGCAGTACGCAGATATGGATG
TTGATCATGTTGCCATTACCCCTCTCATGCGTGGGCTGGATGCACAGTTACCTCTGCATGACAGCCAGCA
GGCTAATGATTTTCTGCAAGAGATGGGCAAAACCATGAAAGCCGCCATTGAAGGGTTATTGGCTCTCCAG
CGTGAACAGCATGGACTGCGTGATAAACAACTACGCCCCATCGAAGATAACCCTCTGCGCCTGAATATGG
ATTATGACACCACCATGCAGGTGATGTTCTCGGATCAGAAAAGCCCGGTTCACTTGTCTGCACCTGCGGC
CGTCTCGGAAAGTCTGCATAACCTGCAATTGCATTATCAGGCCAATCGGGAAGCCATTTCGGCAGCATTG
GACACCATGCTGGAAGCTTTCTCCCCTGATCAATTGCTCCGTCGCTTCTCACATTACCGCCGCAGCAACG
AAGTCAGAAATAAAGATGCGGCCTGGGCGTGGGAAATGTACACCAACTATTACCGTGAATTAGCTTCCAG
CCGCCAGCAGGGGTTCGAAAAGCTATTCCGTGAGGTGTATGAGCAGGCTTATGACCGCGCACTGCGTCAG
GGCTTAGAGGACTCCAGCAATGAAACGTTCCGCTAG