SecReT6
Protein ID: 290473352
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0269
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]276634..277188 [+]
Producthypothetical protein
NoteTssJ
UniProt IDD3UYP2
KEGG IDxbo:XBJ1_0269
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.60E-36, Aligned region: 20..177
Protein Sequence: 184 a.a.     [Download]
>gi|290473352|ref|YP_003466218.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MKRSASHRVWAVGILLLSAMLLNGCSGAWNATKKVGQVIWDPSTPVGKPDEQASVANITLLAEPNINPNE
SGEAAPVEMNLVYLSEDSRFLAADYDQLESDKLEKALGKNYIDHQDYTLLPGQYKPLSTLILEKNNRYIG
VIVHYADANQSEWKKIIRVKDIGRHYNILVHVRNNDVELRKEEE
 
Nucleotide Sequence: 555 bp     [Download]
>gi|290473094|ref|NC_013892.1|:276634-277188 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAAACGTTCCGCTAGTCATCGTGTATGGGCTGTAGGGATTTTATTGTTGTCAGCGATGTTGCTGAATG
GCTGTAGCGGTGCATGGAACGCGACAAAGAAAGTCGGTCAAGTGATCTGGGATCCTTCCACACCAGTAGG
AAAACCGGATGAACAGGCTTCTGTTGCCAACATTACGTTATTGGCCGAACCGAATATCAACCCCAATGAA
AGTGGTGAAGCGGCTCCTGTTGAAATGAATCTGGTTTATCTCAGTGAAGATTCTCGTTTTTTGGCTGCTG
ATTATGACCAGCTTGAAAGCGACAAACTCGAAAAAGCACTGGGGAAAAATTATATCGATCATCAGGATTA
CACACTATTACCGGGGCAATACAAGCCCCTGTCAACGCTGATATTGGAAAAGAATAACCGTTACATCGGT
GTCATCGTTCACTATGCAGATGCAAATCAATCTGAATGGAAAAAGATCATCCGAGTAAAAGACATCGGCC
GCCATTACAACATCTTGGTGCATGTCAGAAATAACGACGTCGAACTTAGAAAAGAGGAGGAGTAG