SecReT6
Protein ID: 290473353
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0270
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]277191..278543 [+]
Producthypothetical protein
NoteTssK
UniProt IDD3UYP3
KEGG IDxbo:XBJ1_0270
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-151, Aligned region: 19..446
Protein Sequence: 450 a.a.     [Download]
>gi|290473353|ref|YP_003466219.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MPGKNRVIWHEGLFIKPQHFQQQQKHNDYLAHSLVSVLAAYGHGFSSLSINQDLLNLGRIGITEASGIMQ
DGTIFSAPSQDLLPKPLDIESVNDLKSKDIYLALPMSSDTIREIADKEAEMQSAVRYRELPSDVRDLHTK
GGDSFALNLAQLTPVLMQGSEDMSAYTAIPLCRIKEKQKDGTIVLDSEFIPTCLSIFVADKLRRFMVEID
GLLTERSRTLAKRIGSPGQQGVADVAEFMMLQLLNRVQPLFNHYAKQTVLHPLHLYTQLLQTCGELRTFT
DASRLPGNVLAYDHNNLTDTFQDAMHAIRDALNVVLTPRATSIVLKQNEGGIRVATLHDNDLLRKAEFVL
AISASTPQEQLRRQFVQQTKVTSMEKIRDLVSVQLPGVPLIALSAAPRQLPYHSGYTYFRLDQKSPAWKE
IQQGNSIAFHVSGDFPDLDMQLWAIRGGKE
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|290473094|ref|NC_013892.1|:277191-278543 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGCCAGGCAAAAATCGGGTGATTTGGCACGAAGGATTGTTCATCAAGCCACAACATTTTCAACAACAAC
AAAAACATAATGATTATCTGGCTCATAGCCTCGTATCGGTGTTGGCCGCTTATGGTCACGGTTTCAGCTC
CTTAAGCATCAATCAGGATCTGCTCAATTTAGGGCGCATCGGCATTACCGAAGCCAGCGGCATCATGCAG
GATGGCACGATATTCTCTGCACCCAGCCAAGATCTGCTGCCAAAACCGCTGGACATCGAAAGCGTCAATG
ACCTGAAAAGCAAAGACATCTATCTGGCATTACCAATGTCCAGCGATACCATTCGGGAAATTGCTGACAA
GGAAGCGGAAATGCAAAGCGCGGTACGTTATCGGGAACTGCCGAGCGATGTCCGTGACCTGCATACCAAG
GGTGGCGATTCCTTTGCCCTGAACCTTGCGCAATTGACGCCGGTTCTGATGCAAGGCTCCGAAGATATGA
GTGCTTACACGGCGATCCCGCTGTGCCGTATCAAAGAAAAACAGAAGGATGGCACTATCGTTCTGGATAG
CGAATTTATTCCGACCTGTCTGTCTATCTTTGTCGCTGACAAGTTAAGACGTTTTATGGTGGAAATCGAC
GGCCTGCTGACTGAACGCTCAAGAACACTGGCCAAACGCATTGGCTCACCGGGTCAGCAGGGCGTTGCGG
ATGTTGCGGAGTTCATGATGCTTCAATTGTTGAACCGCGTGCAACCTCTGTTCAACCATTACGCAAAACA
GACTGTCCTGCACCCGCTGCATTTATATACCCAACTGCTCCAGACCTGCGGTGAGCTGAGAACCTTCACC
GATGCGAGTCGCTTACCGGGGAATGTGCTGGCGTATGACCACAATAATCTGACGGATACTTTCCAGGACG
CGATGCATGCCATTCGTGATGCACTGAACGTTGTTCTGACACCGCGTGCAACGTCAATTGTCCTGAAACA
GAACGAAGGTGGTATCCGCGTGGCAACGCTCCACGACAACGATCTGCTGCGTAAAGCCGAATTTGTACTG
GCTATCAGTGCAAGTACGCCGCAGGAGCAATTACGTCGTCAGTTCGTGCAGCAAACCAAAGTCACCTCGA
TGGAGAAAATCCGCGATCTGGTCAGCGTTCAGTTACCGGGTGTGCCACTGATTGCATTATCCGCGGCTCC
GCGTCAGCTGCCGTATCACTCTGGATACACCTACTTCCGTCTGGATCAGAAGAGTCCGGCATGGAAAGAG
ATCCAGCAGGGGAATTCCATCGCATTCCACGTATCAGGGGATTTCCCTGACTTAGATATGCAGCTCTGGG
CTATCAGGGGCGGTAAGGAATAA