SecReT6
Protein ID: 290473354
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0271
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]278546..279313 [+]
Producthypothetical protein
NoteTssL
UniProt IDD3UYP4
KEGG IDxbo:XBJ1_0271
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.70E-62, Aligned region: 34..239
Protein Sequence: 255 a.a.     [Download]
>gi|290473354|ref|YP_003466220.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MSDINVGSPSLEKSETLKTFQRQYQLPLRGESLNPMIDAATPLLGMVLRLQDMSDQALPDKLYQQVVTDI
RAIEQFLQTKGYEPGAIVSFRYVLCTFIDETALGHGWNSQNGWLKQSLLVHFHNETWGGEKVFVLLERLM
GETQRYQHLLEFIYLCLCLGYRGRYKVSTQKSDDFDRLFRRLQQQLHSLRGEAPPTTLYVDINERDERYR
LSRRWTIKHLFWISVGLLAAIYSFYAIRLGDQTQDILKQLSNLLR
 
Nucleotide Sequence: 768 bp     [Download]
>gi|290473094|ref|NC_013892.1|:278546-279313 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAGTGATATCAATGTTGGCAGTCCGTCACTGGAAAAGTCTGAGACGCTGAAAACGTTTCAGCGCCAGT
ATCAGCTACCGTTGCGTGGTGAAAGCCTCAACCCGATGATCGATGCGGCCACTCCCTTACTGGGAATGGT
TCTGCGTTTGCAGGATATGAGTGATCAGGCACTGCCAGATAAGCTTTACCAACAGGTTGTTACTGACATT
CGAGCCATTGAGCAGTTTCTGCAAACCAAGGGTTATGAACCCGGCGCGATTGTTTCATTCCGTTACGTAC
TATGCACCTTCATTGATGAAACCGCGTTGGGGCACGGCTGGAACAGTCAGAATGGCTGGTTGAAGCAATC
GTTGCTGGTTCACTTCCATAATGAAACCTGGGGAGGCGAAAAAGTTTTTGTATTGCTCGAACGCCTGATG
GGGGAGACCCAGCGCTACCAGCACCTGCTGGAGTTCATTTATCTCTGCCTCTGTCTGGGTTATCGCGGAC
GTTACAAAGTCAGCACCCAGAAAAGCGATGACTTTGATCGCCTGTTCCGTCGCTTGCAGCAACAGCTTCA
CTCACTGCGTGGAGAAGCTCCGCCGACCACGCTATATGTCGATATCAACGAGCGTGATGAGCGTTATCGT
CTGAGCAGACGTTGGACCATCAAGCACCTGTTTTGGATAAGTGTAGGTTTACTGGCTGCCATTTACAGTT
TCTATGCCATCCGCCTCGGTGATCAGACCCAAGACATATTAAAGCAGCTAAGTAACTTATTGAGATAG