SecReT6
Protein ID: 290473355
SecReT6 ID381
T6SS typei1
Gene symbolclpB
Locus tagXBJ1_0272
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]279323..282037 [+]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDD3UYP5
KEGG IDxbo:XBJ1_0272
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.20E-39, Aligned region: 222..327
AAA_2 [PF07724], Evalue: 3.20E-39, Aligned region: 639..800
AAA [PF00004], Evalue: 2.00E-19, Aligned region: 222..333
AAA [PF00004], Evalue: 2.00E-19, Aligned region: 574..607
AAA [PF00004], Evalue: 2.00E-19, Aligned region: 645..765
AAA_5 [PF07728], Evalue: 7.40E-15, Aligned region: 222..253
AAA_5 [PF07728], Evalue: 7.40E-15, Aligned region: 459..482
AAA_5 [PF07728], Evalue: 7.40E-15, Aligned region: 644..765
ClpB_D2-small [PF10431], Evalue: 1.10E-13, Aligned region: 456..478
ClpB_D2-small [PF10431], Evalue: 1.10E-13, Aligned region: 806..880
AAA_16 [PF13191], Evalue: 5.60E-13, Aligned region: 199..242
AAA_16 [PF13191], Evalue: 5.60E-13, Aligned region: 263..300
AAA_16 [PF13191], Evalue: 5.60E-13, Aligned region: 488..566
AAA_16 [PF13191], Evalue: 5.60E-13, Aligned region: 615..681
AAA_16 [PF13191], Evalue: 5.60E-13, Aligned region: 710..738
AAA_16 [PF13191], Evalue: 5.60E-13, Aligned region: 802..846
AAA_22 [PF13401], Evalue: 5.00E-06, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 5.00E-06, Aligned region: 356..388
AAA_22 [PF13401], Evalue: 5.00E-06, Aligned region: 484..553
AAA_22 [PF13401], Evalue: 5.00E-06, Aligned region: 643..663
AAA_22 [PF13401], Evalue: 5.00E-06, Aligned region: 706..738
NACHT [PF05729], Evalue: 5.40E-05, Aligned region: 222..250
NACHT [PF05729], Evalue: 5.40E-05, Aligned region: 645..672
NACHT [PF05729], Evalue: 5.40E-05, Aligned region: 849..874
AAA_14 [PF13173], Evalue: 5.80E-05, Aligned region: 222..357
AAA_14 [PF13173], Evalue: 5.80E-05, Aligned region: 644..733
DUF258 [PF03193], Evalue: 0.00012, Aligned region: 186..239
DUF258 [PF03193], Evalue: 0.00012, Aligned region: 645..660
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 222..244
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 639..673
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 215..238
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 642..666
AAA_19 [PF13245], Evalue: 0.0011, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.0011, Aligned region: 574..586
AAA_19 [PF13245], Evalue: 0.0011, Aligned region: 638..663
IstB_IS21 [PF01695], Evalue: 0.0024, Aligned region: 216..246
IstB_IS21 [PF01695], Evalue: 0.0024, Aligned region: 644..655
Zeta_toxin [PF06414], Evalue: 0.0038, Aligned region: 222..240
Zeta_toxin [PF06414], Evalue: 0.0038, Aligned region: 643..684
Sigma54_activat [PF00158], Evalue: 0.004, Aligned region: 221..236
Sigma54_activat [PF00158], Evalue: 0.004, Aligned region: 644..742
Arch_ATPase [PF01637], Evalue: 0.008, Aligned region: 202..237
Arch_ATPase [PF01637], Evalue: 0.008, Aligned region: 275..309
Arch_ATPase [PF01637], Evalue: 0.008, Aligned region: 508..554
Arch_ATPase [PF01637], Evalue: 0.008, Aligned region: 645..665
Arch_ATPase [PF01637], Evalue: 0.008, Aligned region: 715..726
MobB [PF03205], Evalue: 0.0098, Aligned region: 222..244
MobB [PF03205], Evalue: 0.0098, Aligned region: 644..664
Protein Sequence: 904 a.a.     [Download]
>gi|290473355|ref|YP_003466221.1| clpB gene product [Xenorhabdus bovienii SS-2004]
MIQIDLPTLVNRLNPMTRHALEAAAASCVSQQQPEITVAQLLFQMIDTPLSDVRLILNKADIDKDLLKEQ
LDQMMPHHQAIVQTYPNFSPMLVEWLQDSWLLASTEMQHTELRGGVMLIALLFSPMRYLTPQPARMLAGI
NRELLRQNFTEWTNGSAEQPFSGDDKNGQGVHPANSDSLLARFTQNMTEQARQGKLDPVLCRDNEIDLMI
DILCRRRKNNPIVVGEAGVGKSALIEGLALRIINDRVPDKLRHSELMTLDLGALQAGAAVKGEFEKRFKG
IMAEISQSSKPIILFIDEAHTLIGAGNQAGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPSAEEATVIMRGLRAIYEQAHGVLIDDEALKASAVLSDRYLSGRQLPDKAIDVLDTACARV
AINLTSPPRQISSLTTELHQMQMEIDVLKREQRMGLNEHADRLEELQNQQVEIQEELVTLEKNWRQQQEL
VTQIIELRGQLLADSDESVAAETTDKTIENAVEETAQDAKEQEAIAQDEPEAAADEQSLIEKLALLNAQL
TELQQKQTLVSPHVDKTQIASVIAEWTGVPLNRLSQSELSIVTELPTHLGQSIKGQDVAIQNLHKHLLTA
RADLRRPGRPLGAFLLVGPSGVGKTETVLQIAELMFGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYG
EGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGELADGEGRIIDCKNVVFFLTSNLGYQTIVD
HAEQPDQLNDLLYPELAAFFKPALLARMEVIPYLPLGHETLKTIIQSKLARLDSLLSQRFNAEVTISDDV
SEEILQRATRAENGARMLESIIDGALLPPVSLLLLQKMAAGTAISAIRLTVAEHEFHAEVEEAE
 
Nucleotide Sequence: 2715 bp     [Download]
>gi|290473094|ref|NC_013892.1|:279323-282037 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGATTCAGATTGATCTGCCCACTCTTGTAAACCGTTTAAACCCGATGACCCGCCATGCACTGGAAGCGG
CGGCGGCATCCTGTGTCAGCCAACAGCAGCCTGAAATTACTGTTGCACAACTGTTGTTTCAGATGATCGA
CACACCACTCAGTGATGTGCGCCTGATCCTCAATAAGGCAGACATCGATAAAGATCTGCTGAAAGAACAA
CTCGATCAGATGATGCCTCATCATCAGGCGATTGTACAAACCTACCCGAACTTCTCACCGATGCTGGTGG
AATGGTTACAGGATAGCTGGCTGCTGGCTTCTACGGAGATGCAGCATACTGAATTACGCGGTGGCGTCAT
GCTGATTGCTCTGCTGTTCAGTCCAATGCGTTATCTGACTCCACAGCCCGCGCGCATGCTGGCGGGTATC
AACCGTGAATTGCTGCGTCAGAACTTTACTGAATGGACGAATGGCTCTGCCGAACAGCCTTTCAGCGGCG
ACGATAAAAATGGGCAGGGCGTCCATCCGGCAAACAGCGACAGCCTGCTGGCGCGTTTTACCCAGAATAT
GACTGAACAGGCGCGTCAGGGCAAACTTGATCCTGTGCTGTGCCGTGATAACGAAATCGATCTGATGATC
GACATTCTCTGCCGTCGCCGCAAAAACAACCCGATCGTCGTGGGTGAAGCGGGGGTGGGTAAAAGTGCCC
TGATTGAAGGTCTGGCGCTGCGCATCATCAATGACCGCGTACCGGATAAATTGCGCCACAGTGAACTGAT
GACACTGGATCTGGGGGCATTGCAGGCAGGGGCTGCGGTTAAAGGTGAGTTTGAAAAACGCTTCAAAGGC
ATCATGGCTGAAATTAGTCAATCATCTAAGCCGATCATCCTGTTTATCGATGAAGCGCACACCCTGATTG
GTGCCGGTAACCAGGCTGGCGGACTGGATATTTCCAATCTGCTGAAACCTGCATTGGCACGTGGTGAACT
GAAAACCATCGCAGCGACTACATGGAGCGAGTACAAAAAATACTTCGAAAAGGACGCAGCACTGTCTCGT
CGCTTCCAATTAGTGAAAGTCTCTGAGCCAAGCGCGGAAGAAGCCACTGTGATCATGCGTGGTTTGCGCG
CCATTTACGAACAGGCGCATGGTGTTCTGATCGATGATGAAGCACTGAAAGCCTCTGCGGTACTGAGTGA
CCGTTATCTCTCTGGCCGCCAACTGCCGGACAAAGCGATTGACGTACTGGATACCGCCTGTGCCCGTGTC
GCCATTAACCTGACATCGCCACCACGTCAGATCTCCTCACTGACGACTGAATTGCACCAGATGCAAATGG
AAATCGATGTTCTGAAAAGAGAACAGCGGATGGGGCTGAATGAACATGCGGACAGACTGGAAGAACTGCA
AAACCAGCAGGTAGAGATCCAAGAAGAACTCGTCACGCTGGAAAAAAACTGGCGGCAACAGCAAGAGTTG
GTGACACAGATCATCGAATTGCGCGGCCAACTCCTGGCGGATAGCGACGAGTCAGTTGCAGCAGAAACGA
CGGATAAAACCATCGAAAATGCGGTTGAAGAGACGGCTCAAGACGCGAAAGAGCAGGAAGCTATTGCGCA
AGACGAGCCAGAAGCCGCCGCTGATGAGCAATCCCTGATCGAAAAACTGGCTCTGCTCAACGCACAACTG
ACAGAGTTACAGCAGAAGCAAACGCTGGTTTCTCCCCATGTAGACAAAACGCAGATTGCCTCGGTTATCG
CTGAGTGGACGGGCGTTCCATTGAACCGCCTGTCACAGAGCGAACTGTCTATCGTGACCGAACTGCCTAC
CCATCTGGGACAAAGCATCAAAGGGCAGGATGTTGCGATCCAGAACCTGCATAAACACCTGCTGACCGCT
CGTGCAGATTTGCGTCGTCCGGGACGTCCTCTGGGCGCATTCCTGCTGGTGGGGCCAAGTGGTGTTGGTA
AAACCGAAACCGTGCTGCAAATTGCTGAACTGATGTTTGGGGGGCGCCAATACCTCACCACCATCAACAT
GTCTGAGTTTCAGGAGAAACATACCGTTTCCCGCCTGATTGGCTCTCCCCCGGGCTACGTAGGTTATGGG
GAAGGTGGTGTACTGACCGAAGCCATTCGCCAGAAACCGTACTCCGTTGTGCTGCTGGATGAAGTCGAAA
AAGCGCATCCTGATGTACTGAACCTGTTCTATCAGGCCTTCGACAAAGGCGAACTGGCCGATGGCGAAGG
GCGTATCATCGACTGTAAAAATGTCGTGTTCTTCCTGACTTCTAACCTTGGTTATCAAACTATCGTTGAT
CATGCCGAGCAGCCAGATCAACTTAACGACCTGCTCTACCCTGAACTGGCCGCGTTTTTCAAACCCGCAT
TGCTGGCGCGTATGGAAGTGATCCCTTACCTGCCTTTGGGTCACGAAACGCTGAAAACCATCATTCAGAG
CAAGCTGGCTCGACTGGATAGCCTGCTGTCTCAGCGCTTTAACGCCGAAGTCACGATCAGCGATGACGTA
TCGGAAGAGATCCTGCAACGTGCCACCCGTGCGGAAAACGGCGCCCGTATGCTGGAATCCATCATTGATG
GTGCACTATTACCGCCTGTTTCATTACTGCTGTTGCAGAAAATGGCCGCAGGCACCGCAATCAGTGCCAT
TCGCTTAACCGTAGCAGAACATGAGTTCCATGCTGAGGTTGAGGAGGCAGAATAA