SecReT6
Protein ID: 290473358
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0275
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]283499..284935 [+]
Producthypothetical protein
NoteTssA
UniProt IDD3UYP8
KEGG IDxbo:XBJ1_0275
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-15, Aligned region: 54..112
ImpA-rel_N [PF06812], Evalue: 1.40E-15, Aligned region: 150..159
ImpA-rel_N [PF06812], Evalue: 1.40E-15, Aligned region: 390..402
Protein Sequence: 478 a.a.     [Download]
>gi|290473358|ref|YP_003466224.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MDIRTQFDWFGALLAPLSDEQTGKALSESDPAWEFIDGEMVKFGSLSHGTLEVDALQRQALQLFSEHSKD
FRLMVHLLRTLQHAGHPAELILAIELLTEYVKNYWEKAWPVKPVLKRRLAQQVIKRFESAQSSFTDQASK
SQRDEAQGALAHLAQCWHASEPDLAKDVDQLRTRYNRQPEARTAPTQTAPTTPEAASVAPSPQSPEQAPM
PEVAVNSSSDKAWKQTLMTVADLLCERYPESPIGYSLRRHAVWHTITTAPMANATGKTPLAPASADRTAD
YLARLPTADNKLLAQIEQSLALAPYWLDGHAIAAQAAEQRGYSRVAQAMRDELKAFLARLPVLKTLSFSD
LSPFISPDTLDWLTPEPDTSGSPGAASADQEAIWHCFQQQGLEAALQMLEEHQQSLTEPRDQFYGQLFTA
QLLEEAGMTALAHQHYRNLLHTGQHMLLTEWEPSLLTLLAEKIPSPAKDTASHRSVNT
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|290473094|ref|NC_013892.1|:283499-284935 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGACATCAGAACACAATTCGACTGGTTCGGCGCCCTGCTGGCGCCCCTGTCCGACGAACAGACGGGCA
AGGCACTGAGTGAGAGTGATCCCGCCTGGGAATTCATCGACGGCGAGATGGTCAAATTCGGCTCGCTGTC
ACATGGCACGCTGGAAGTTGACGCCCTCCAGCGACAGGCCTTGCAACTTTTCAGCGAGCACAGCAAGGAC
TTCCGGCTGATGGTTCACCTGCTGCGGACTTTGCAGCATGCCGGCCACCCTGCCGAGCTGATTCTGGCGA
TAGAGCTGCTGACAGAGTACGTAAAAAACTACTGGGAAAAAGCCTGGCCGGTCAAACCGGTATTGAAGCG
CCGGCTGGCACAGCAGGTGATCAAACGGTTTGAATCGGCCCAGTCGAGCTTCACTGATCAGGCCAGTAAA
AGCCAGCGCGACGAGGCACAAGGCGCTCTGGCTCATCTGGCTCAGTGCTGGCACGCCAGTGAGCCCGACC
TTGCGAAAGACGTCGATCAACTGCGTACCCGCTATAACCGCCAGCCAGAGGCACGAACGGCGCCGACACA
GACGGCACCTACCACCCCTGAAGCGGCGTCGGTAGCTCCGTCGCCTCAGTCTCCTGAACAGGCGCCGATG
CCTGAGGTGGCGGTCAACAGTTCCAGTGATAAAGCATGGAAACAAACCCTGATGACGGTGGCGGATCTGC
TGTGTGAACGGTATCCCGAATCCCCGATTGGCTATAGCCTGCGCCGCCATGCGGTCTGGCACACCATTAC
CACGGCGCCGATGGCGAACGCCACAGGCAAAACGCCGCTGGCGCCGGCGTCGGCGGATCGTACCGCCGAT
TATCTGGCGCGACTGCCGACGGCGGATAACAAATTGCTGGCGCAAATTGAGCAGAGCTTAGCCCTCGCCC
CTTACTGGCTGGACGGCCATGCCATTGCCGCCCAAGCGGCGGAACAACGCGGCTACAGCCGCGTTGCGCA
GGCCATGCGTGACGAACTGAAGGCGTTTTTGGCTCGGCTGCCTGTACTGAAAACCTTAAGTTTTTCCGAC
CTGAGTCCGTTTATTTCTCCTGACACTCTGGACTGGCTCACGCCGGAACCCGACACCAGCGGAAGCCCGG
GAGCCGCGTCGGCCGATCAGGAAGCCATCTGGCACTGCTTCCAGCAGCAAGGGCTGGAAGCCGCCCTTCA
GATGCTGGAAGAACACCAGCAGTCACTGACGGAGCCCCGGGATCAATTCTATGGTCAGTTGTTCACTGCC
CAACTGCTTGAAGAAGCGGGCATGACCGCACTGGCACACCAGCATTACCGGAACTTGTTACACACGGGAC
AACACATGTTACTCACTGAATGGGAACCCAGCCTGCTGACCCTGCTGGCTGAAAAAATACCTTCGCCTGC
GAAGGATACTGCGTCACACAGGAGCGTTAACACATGA