SecReT6
Protein ID: 290473361
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0278
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]289991..293062 [+]
ProductRhs accessory genetic element
NoteTssI
UniProt IDD3UYQ1
KEGG IDxbo:XBJ1_0278
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-71, Aligned region: 146..445
Phage_base_V [PF04717], Evalue: 8.50E-23, Aligned region: 484..576
Phage_lysozyme [PF00959], Evalue: 1.90E-13, Aligned region: 898..1009
Protein Sequence: 1023 a.a.     [Download]
>gi|290473361|ref|YP_003466227.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MSMKKNMAKLKKGRALIQQGQQAAQLAKHVTGKLGGGLGGAAAGTAGLIPGGGFGGGIGGGSAGTGAAGL
IPGGGFGGGLGGAGGGAGQGLAARAASGQSGAAKALQKAGQLLGGGGGMAPSGLQFTLTAGGLPPETFVV
TDFALTEGFSRPFSLHVGLASADPAIDFPAVLDRSATLTILQEGVEQRSITGIVARFEQGNTGLHQTTYQ
MSLYPDLWRTTLRQNSRIFQQLDIAAILTTLLKEHGIRDVVFSLRHPHPAREFCVQYQESDFAFLQRLTA
EEGIFYFFECGNGRNTLVFADDAGSVPPGIVLAYQPGEGSTTGTPSVGSFTCSAQVRPAQVQLKDYTFKN
PAWPAEFSQQMKEDTLQQMYYEHYDYPGRFKDEAHGQAFTRYRLEALRSDAVTGQASGQAIAVQPGKLFT
LFNHPREDLNQPWQVVGASHTGSQPQARETASSDSGTTLHSQFSFIRHNQHWRPAPLPKPTIDGPQIAKV
VGPAGEEIFCDQYGRIRLQFPWDRYGKSDDQSSCWIRVSQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQ
PIVTGRTYHASNIPPGALPGSKTQMAFRSKTHKGEGYNELLFEDAKGSERLALHAQKDMHTTVKDNQSLV
VEAGDRTLTVQTGDEHKTVKQGNLTETICQTRSTEANVIQVKAKAGKAGLGTQLYQAEDNITLQVGKGSI
EMTPEHIRVAFGSSVILLNSSGVFVDGPAIGLNNGSAGAGLPPAAADGGDSASESGSLLPAAVMAAGLGP
MGMAALGSMGLISSASAATPASAPRPMPTPADGAGRQAAPADSQATPASAPRSMPVPVNGAGRQAVPAGS
QVAAPSAPPVSATNLTTSTKKTMGQDGLDLLKGIESLRLKPYDDQTGKTVTKWTKGATIGYGKLIEKKDW
DTYKDGITEDEAEELFKKTLAPFEKTVNDGITKEINQNQFDALTMFAYNIGAKGFNDSSVLKLVNDENAK
TDYDTLDDAWKAWNKSQGKVNQGVINRRAAELKIYNEGVYERW
 
Nucleotide Sequence: 3072 bp     [Download]
>gi|290473094|ref|NC_013892.1|:289991-293062 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGTCGATGAAAAAGAATATGGCAAAACTGAAGAAAGGGCGGGCGCTGATCCAGCAGGGACAGCAGGCCG
CCCAGCTGGCAAAACACGTCACTGGTAAGCTGGGGGGCGGCCTTGGCGGCGCAGCCGCAGGCACCGCCGG
CTTAATTCCGGGCGGCGGCTTTGGCGGGGGTATCGGGGGCGGCTCAGCAGGCACCGGCGCGGCGGGCTTA
ATCCCGGGCGGTGGCTTTGGCGGCGGATTGGGTGGTGCCGGGGGGGGAGCCGGGCAGGGACTGGCCGCGC
GGGCGGCGAGTGGTCAGAGCGGGGCGGCCAAGGCGCTGCAAAAAGCCGGCCAGTTATTGGGCGGCGGGGG
GGGCATGGCCCCGAGCGGGCTGCAGTTTACCCTGACGGCGGGCGGCCTGCCGCCGGAAACCTTTGTCGTG
ACGGACTTCGCCCTGACGGAAGGCTTTTCCCGGCCGTTCAGCCTGCATGTCGGGCTGGCGAGTGCCGACC
CGGCGATTGACTTTCCGGCGGTGCTCGACCGCAGCGCGACCCTGACCATTCTGCAGGAGGGGGTGGAGCA
GCGCAGTATCACCGGGATAGTGGCGCGTTTCGAGCAGGGCAACACCGGCTTGCACCAGACCACCTACCAG
ATGAGCCTCTACCCGGATTTGTGGCGCACCACCCTGCGGCAGAACTCGCGTATCTTCCAGCAGCTGGACA
TCGCCGCTATCCTCACCACGCTTTTGAAAGAGCACGGTATCCGCGACGTGGTGTTCAGCCTGCGCCATCC
GCATCCGGCGCGGGAATTCTGCGTGCAATATCAGGAAAGCGACTTTGCCTTCCTCCAGCGGCTGACCGCG
GAAGAGGGCATCTTTTATTTCTTCGAATGCGGTAACGGCCGTAACACGCTGGTGTTTGCCGATGACGCCG
GCTCCGTGCCGCCGGGCATTGTGCTGGCGTACCAGCCGGGGGAAGGCAGCACGACGGGCACACCGTCGGT
GGGCAGCTTTACCTGCAGTGCGCAGGTGCGCCCGGCACAGGTGCAGCTCAAGGACTACACCTTCAAAAAC
CCGGCGTGGCCGGCAGAATTCAGCCAGCAGATGAAGGAAGACACCTTACAGCAGATGTACTACGAGCACT
ACGACTACCCGGGGCGGTTTAAGGACGAAGCCCACGGCCAGGCCTTCACCCGCTACCGGCTGGAAGCGCT
GCGCAGTGACGCGGTGACGGGACAGGCCAGCGGGCAGGCCATTGCCGTGCAACCGGGCAAATTATTTACC
CTGTTTAACCACCCGCGTGAAGACCTGAACCAGCCGTGGCAGGTGGTGGGCGCGAGCCACACCGGCAGCC
AGCCGCAGGCGCGGGAAACCGCCAGCAGCGACAGCGGCACCACGCTGCACAGCCAGTTCAGCTTCATCCG
CCACAACCAGCACTGGCGGCCGGCCCCGTTGCCGAAACCGACCATTGACGGCCCGCAGATTGCCAAGGTG
GTGGGGCCGGCCGGGGAAGAAATCTTCTGTGACCAGTACGGGCGCATCCGGCTGCAGTTCCCGTGGGACC
GATACGGAAAAAGCGACGACCAGAGTTCGTGCTGGATACGGGTGAGCCAGCCGTGGGCCGGGCAGGGCTG
GGGCATGCTGGCGATTCCGCGCATCGGTCAGGAAGTGGTGGTGGACTTCCTGCACGGCGACCCGGACCAG
CCGATTGTGACCGGCAGAACGTATCACGCCAGTAACATCCCACCGGGCGCGCTGCCGGGCAGCAAGACCC
AGATGGCGTTCCGCTCCAAGACCCACAAGGGGGAGGGGTATAACGAACTGCTGTTTGAGGATGCGAAGGG
CAGTGAAAGGCTGGCGCTGCATGCGCAGAAGGACATGCACACCACGGTGAAAGATAACCAGAGCCTGGTG
GTGGAGGCGGGTGACCGCACGCTGACTGTCCAGACGGGGGATGAGCACAAAACCGTTAAACAGGGCAATC
TGACGGAGACCATCTGCCAAACCCGCAGCACCGAGGCCAACGTGATACAGGTGAAGGCGAAGGCGGGCAA
AGCGGGGCTGGGAACGCAGCTGTATCAGGCTGAGGATAATATCACTCTGCAGGTGGGTAAGGGTAGCATC
GAGATGACACCGGAGCATATCCGGGTGGCATTTGGCTCATCGGTTATCCTGCTGAACAGCAGCGGAGTCT
TTGTGGATGGCCCGGCTATTGGGTTGAACAACGGCAGTGCAGGAGCGGGACTGCCGCCGGCCGCCGCAGA
CGGGGGTGACAGTGCTTCGGAGAGTGGAAGTTTGCTTCCGGCAGCGGTGATGGCGGCGGGTCTGGGACCG
ATGGGGATGGCGGCTCTGGGATCGATGGGGCTGATTTCTTCCGCGTCGGCGGCAACGCCAGCATCAGCAC
CAAGACCTATGCCCACTCCCGCCGATGGGGCAGGGAGACAGGCAGCACCTGCTGACTCTCAGGCAACGCC
AGCATCCGCTCCAAGATCTATGCCTGTTCCAGTCAATGGGGCAGGGCGACAAGCAGTACCTGCTGGTTCT
CAGGTAGCGGCACCATCAGCACCCCCTGTATCTGCAACTAATTTAACCACCAGCACGAAAAAGACCATGG
GACAAGATGGACTGGATTTATTAAAAGGTATCGAGTCATTGAGATTAAAACCTTATGATGACCAGACAGG
GAAAACCGTCACCAAATGGACTAAAGGCGCTACAATTGGCTATGGTAAATTAATTGAGAAGAAAGACTGG
GATACCTATAAAGACGGTATTACCGAAGATGAGGCTGAGGAGTTATTTAAAAAGACACTGGCACCTTTTG
AGAAAACCGTTAATGACGGAATTACAAAAGAGATAAACCAGAATCAGTTTGATGCCTTAACCATGTTTGC
ATATAACATTGGTGCAAAAGGATTCAATGATTCATCTGTTCTAAAACTGGTAAATGATGAAAATGCCAAA
ACCGACTATGACACGCTGGATGATGCCTGGAAGGCTTGGAATAAATCGCAAGGCAAAGTTAATCAGGGCG
TAATAAACAGACGCGCAGCTGAGTTAAAAATCTATAACGAAGGAGTTTATGAAAGATGGTAA