SecReT6
Protein ID: 290475112
SecReT6 ID382
T6SS typei3
Gene symbol-
Locus tagXBJ1_2097
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]2056281..2057357 [-]
Producthypothetical protein
NoteTssG
UniProt IDD3V3A8
KEGG IDxbo:XBJ1_2097
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-95, Aligned region: 24..338
Protein Sequence: 358 a.a.     [Download]
>gi|290475112|ref|YP_003467996.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MKTDITAIHRVCRLPEYFWQQLTQAPWQFDLFQTLRRIDAQAGGYYRLGTAPLPRYEPLRLGQKASMAFA
PSTISTVHQLKNSKLYEVLIYSFGLFGPNGPLPLHLTEYTYSREYNYQDPTLGAFTNLFHHRLILLFYRA
WANAQPTSSLDRPDNQKFCHYMACLIGMGLSAQQNSNPVNHNHITRNSINNHAHYALSGHLSRQRHNAEG
LKKIMLFYFKVPVKIIQNIPQWLQIETQDQARLAAGRHVPCLGKSAILGIAIHDIQHKFRIELGPLTQAE
YDMFLPEQTKSQQVREWVYQYLGIEYGWDIRLILDKSDITEMRLSETGKLGLNSWLGKVNKSSHYDDLIY
NPKSCKTH
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c2057357-2056281 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAAAACAGATATTACGGCCATTCATCGTGTATGCCGCTTGCCAGAGTATTTTTGGCAACAACTCACCC
AAGCCCCCTGGCAATTTGATCTGTTCCAGACCCTACGTCGCATTGATGCCCAAGCGGGAGGGTATTACCG
ATTAGGGACAGCCCCATTACCACGCTATGAACCTTTGCGCTTGGGACAAAAAGCGTCAATGGCATTCGCA
CCTTCCACAATTTCCACAGTCCATCAGTTAAAAAATTCAAAACTCTACGAAGTACTTATTTACAGCTTCG
GATTATTTGGTCCCAATGGCCCATTACCTCTGCACCTGACTGAATATACCTATTCACGGGAATATAATTA
TCAAGATCCCACTTTGGGTGCCTTTACCAATCTATTTCACCATCGGCTGATACTCCTGTTCTATCGAGCC
TGGGCCAATGCACAACCTACCTCATCATTAGATAGACCTGACAACCAGAAGTTTTGTCATTATATGGCTT
GCCTGATAGGGATGGGATTGTCAGCCCAGCAGAATTCCAACCCGGTCAATCACAATCACATTACCCGTAA
CTCTATTAACAATCATGCCCATTACGCGTTGTCCGGCCATCTTTCCCGCCAGAGGCATAATGCGGAAGGG
TTGAAAAAAATAATGCTTTTTTATTTCAAGGTTCCCGTAAAAATTATCCAAAATATTCCACAATGGTTGC
AGATTGAAACGCAAGATCAGGCGCGACTGGCAGCAGGACGTCATGTGCCCTGTTTAGGTAAGTCCGCCAT
TTTGGGCATTGCAATACATGATATTCAACATAAATTCCGTATTGAACTAGGGCCATTAACTCAGGCAGAG
TACGACATGTTTCTGCCTGAACAGACGAAATCTCAACAAGTGCGTGAGTGGGTTTATCAATACTTAGGTA
TCGAGTACGGCTGGGATATTAGGCTGATACTTGATAAATCAGACATCACCGAAATGCGCCTGTCAGAAAC
GGGGAAATTGGGACTCAATAGCTGGCTGGGTAAGGTTAACAAATCAAGCCATTATGATGACTTAATCTAC
AACCCTAAATCCTGCAAGACGCATTAA