SecReT6
Protein ID: 290475113
SecReT6 ID382
T6SS typei3
Gene symbol-
Locus tagXBJ1_2098
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]2057415..2059289 [-]
Producthypothetical protein
NoteTssF
UniProt IDD3V3A9
KEGG IDxbo:XBJ1_2098
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.10E-200, Aligned region: 5..624
Protein Sequence: 624 a.a.     [Download]
>gi|290475113|ref|YP_003467997.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MDSKLLEYYNRELVYLREMGKEFAERYPKIANRLGMHGIDIADPYVERLIEGFAFLTSRIQLKMDAEFQH
FSQHLLEMLYPNYLAPTPSMAITELQPDMSKGDISHGFLVPHGSIMRCQSLENDGITLQYSTTQDVILQP
LKLQKVELGKIPANFPLVGLNLHHYGAVSALRIRLACKGKLFLHDLDLNKLTFFLSGPDIQSQKLLELIM
EHSVGMVCQTQGASPQYLTLPDIAPHHEGFDDEQALLPNDPRNFSGYRQVQEYFAFPARFRFFSICGMQP
LLKETKEDVEFELILLLNKTDSRLESLIDISYLALNCTPVINLFPKMTERLTVDESTNEYHLVVDNTRPL
DYEIFSVQRLLGIDAQHKQERIFRPFWSTNSDDPDNYGAYFSLRREPRILSEHAHHYGTRTSYIGTETFI
SIVDEHHSPWPDTLRYLSADVMCTNRDLPAMLRQKDINSFAMLDSIPISKIEFIKRPTIPRPALAEGAVS
WKLISQLQINYMNFMDQNQEEGTQTLRQLLSLYADLAEPAVVRQINGIRHCSLKEVYRRVPDTGLIVFAR
GVSIKLEVDEQEFAGASPWLLGSVLEKLFSRLVTINAFTEMTLYSQQRGQVGFWPARMGSKKLI
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c2059289-2057415 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGATAGCAAACTATTGGAATACTATAACCGAGAGTTGGTGTACTTACGTGAAATGGGTAAAGAGTTTG
CGGAACGCTACCCCAAAATTGCCAATCGATTAGGCATGCATGGCATTGATATCGCCGATCCCTATGTTGA
ACGCCTGATAGAAGGGTTTGCTTTCTTGACTTCCCGCATCCAGTTAAAAATGGATGCCGAATTTCAGCAT
TTTTCCCAGCATTTACTGGAAATGCTCTATCCCAATTATCTGGCTCCCACCCCTTCCATGGCCATTACAG
AACTCCAACCAGACATGAGTAAGGGAGATATCAGCCACGGTTTTCTGGTGCCACACGGCTCGATTATGCG
CTGCCAGTCTCTGGAGAACGATGGCATTACCTTGCAATATTCCACGACTCAGGATGTCATCTTACAACCG
CTGAAACTACAAAAAGTTGAGCTTGGCAAGATCCCCGCCAATTTTCCTCTGGTGGGTTTAAACCTTCATC
ACTATGGTGCAGTCAGTGCATTACGTATCCGCCTTGCCTGTAAGGGAAAGCTCTTTCTCCACGATTTGGA
TCTTAATAAACTGACCTTTTTTCTTTCAGGGCCAGATATTCAATCCCAAAAACTGCTGGAACTGATAATG
GAGCACTCGGTTGGGATGGTATGCCAAACTCAGGGAGCCTCCCCACAATACCTGACATTGCCTGACATTG
CTCCACATCATGAAGGTTTTGATGATGAGCAAGCCCTCTTACCCAATGATCCCCGTAATTTCAGTGGATA
TCGCCAGGTTCAAGAATATTTTGCCTTTCCGGCACGTTTTCGATTTTTCAGTATTTGTGGTATGCAACCT
TTGCTCAAGGAGACCAAGGAAGACGTTGAATTCGAACTTATTCTGCTCTTAAACAAAACCGATAGCCGTT
TGGAAAGCCTGATCGATATTTCCTATCTGGCATTGAACTGTACACCTGTGATCAATTTATTTCCCAAAAT
GACCGAGCGATTGACGGTTGATGAAAGTACCAATGAATATCATCTGGTCGTGGATAACACCCGTCCATTA
GATTACGAAATTTTTTCCGTGCAACGTTTACTCGGTATCGATGCACAACATAAGCAAGAGCGTATATTTC
GTCCTTTTTGGTCAACTAATAGCGATGATCCTGATAATTACGGTGCCTATTTTTCACTGCGCCGGGAGCC
ACGCATATTGTCTGAACACGCCCATCATTATGGCACCCGCACGAGCTATATCGGCACAGAAACATTTATC
TCTATTGTGGATGAACATCACTCTCCGTGGCCTGATACATTAAGGTATCTGAGTGCCGATGTGATGTGTA
CTAACCGAGATCTACCCGCAATGTTGCGGCAAAAAGATATCAATAGCTTTGCCATGCTGGACTCCATCCC
GATCAGTAAAATTGAGTTTATTAAAAGGCCGACCATCCCTCGCCCTGCTCTGGCTGAAGGGGCTGTATCA
TGGAAATTAATCAGCCAGCTTCAAATTAATTACATGAATTTTATGGATCAAAACCAAGAAGAAGGCACCC
AGACGCTACGACAGCTATTAAGTCTCTATGCCGACCTTGCTGAGCCAGCAGTCGTACGCCAGATTAATGG
CATACGACACTGCTCATTAAAAGAAGTCTATCGTAGAGTGCCCGATACTGGCCTTATCGTCTTTGCCCGT
GGTGTCAGCATTAAACTCGAAGTCGATGAGCAGGAGTTTGCCGGCGCCAGCCCGTGGCTTTTAGGCAGTG
TGCTGGAAAAATTATTCTCGCGTTTGGTCACCATAAACGCCTTTACTGAAATGACACTGTATAGCCAGCA
ACGTGGACAAGTTGGCTTCTGGCCTGCCCGCATGGGCAGCAAGAAGTTAATATAA