SecReT6
Protein ID: 290475115
SecReT6 ID382
T6SS typei3
Gene symbol-
Locus tagXBJ1_2100
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]2059923..2061476 [-]
Producthypothetical protein
NoteFha
UniProt IDD3V3B1
KEGG IDxbo:XBJ1_2100
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-05, Aligned region: 27..95
Protein Sequence: 517 a.a.     [Download]
>gi|290475115|ref|YP_003467999.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MRFTIVKNIGTSQPQQLSYDFMPPGGTIGRSPDNNWILPDEGQAIARLQATVSVSIDGECRMTNRGAASD
ILLNTIPIAPDRRIEIRDGDTLNIGDYQIQVININQGSNNTNSVNTPPLTTIRKDIPSEIWDGLENTFTP
DESMPQTPQQVAKTLNDNNPLIKPQRHQERNPINPLEQMETIIDLDSLQHRATDPITMFNANTDSQQENI
LNDSTPSTLLQQGNQRDKPEIDPLILFSDKHRRGILHDEPLNWVMENAEPLVAQANTGSSDPQYGASDPP
FHRHNNEHLDIDPVTYPPNPHQPDQAEEGVKLEGQLLAALLEGMGLNHLQNLQFDGHTLYKLGKLLSQLS
QGIIALNASRTQLKYETDTGVAQILVDGNNPFALFPSGQAVLIQMIGEHMPGFMSAEQATRDILIELQAH
QLGMIAGLRTITAEMLQRFDPLVVKQKAQAAGRLPRLALSSTYKAALWDYFTKHYQKNMEKIEQDHTIFG
EQFRQAYESEIIRYKHSQDKLKNKDKK
 
Nucleotide Sequence: 1554 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c2061476-2059923 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGCGATTCACCATTGTTAAAAATATTGGTACAAGCCAGCCGCAACAACTGAGTTATGATTTTATGCCAC
CCGGTGGCACAATTGGCCGCTCCCCAGATAATAACTGGATTTTGCCCGATGAAGGGCAGGCTATAGCTCG
TTTACAGGCCACTGTATCTGTTTCCATCGATGGAGAATGTCGTATGACCAATCGGGGGGCTGCCTCTGAT
ATTTTGTTAAATACCATCCCCATCGCTCCCGACCGGAGGATTGAAATACGCGATGGTGATACGTTAAATA
TCGGTGATTACCAAATCCAAGTCATTAATATTAACCAAGGTTCGAATAATACGAATAGTGTGAACACGCC
ACCATTGACAACAATTCGCAAAGATATTCCCAGTGAAATTTGGGATGGATTGGAGAACACGTTTACGCCC
GATGAAAGCATGCCTCAGACTCCCCAACAAGTTGCTAAGACACTCAATGACAATAATCCACTCATAAAAC
CTCAGCGGCATCAGGAACGTAATCCAATAAACCCTCTCGAACAGATGGAAACAATAATTGATCTGGATTC
CTTGCAACACCGTGCCACGGATCCAATCACGATGTTTAATGCAAACACGGATAGCCAGCAGGAAAATATT
CTCAATGACAGTACGCCCAGTACCTTATTGCAGCAGGGCAATCAGCGCGATAAACCAGAAATTGATCCCC
TGATTCTATTTTCCGATAAACATCGGCGGGGGATTTTGCATGATGAGCCGCTAAATTGGGTAATGGAGAA
TGCTGAACCTTTGGTCGCACAGGCTAATACAGGCTCTTCTGACCCTCAATATGGTGCCAGTGATCCCCCT
TTCCACCGTCATAACAATGAACACTTGGATATCGACCCAGTGACATATCCGCCTAATCCCCATCAACCCG
ATCAGGCCGAAGAAGGTGTTAAATTAGAGGGTCAACTCTTAGCCGCTTTATTGGAGGGTATGGGGCTTAA
TCATCTCCAAAACCTGCAATTTGATGGGCATACCCTGTATAAACTGGGGAAATTACTTAGCCAGTTATCA
CAAGGCATTATAGCGTTAAATGCGTCACGCACACAGTTGAAATATGAGACTGATACCGGAGTTGCCCAGA
TTCTGGTGGATGGCAACAATCCCTTTGCACTTTTTCCTTCGGGTCAAGCGGTGCTGATCCAAATGATTGG
CGAACATATGCCAGGATTTATGTCAGCAGAACAGGCAACACGAGATATTTTAATCGAGTTACAAGCACAT
CAATTGGGTATGATTGCCGGTTTACGCACTATTACGGCAGAGATGTTACAACGATTTGATCCCTTAGTGG
TTAAACAAAAAGCACAAGCTGCCGGCAGACTGCCTCGTTTGGCATTATCATCAACGTATAAAGCTGCTTT
ATGGGACTATTTCACCAAACATTATCAGAAAAATATGGAAAAAATTGAACAGGATCACACTATATTTGGT
GAACAGTTTCGGCAAGCCTATGAGTCAGAAATTATCCGATATAAACACTCACAAGATAAATTAAAGAACA
AAGATAAAAAATAA