SecReT6
Protein ID: 290475116
SecReT6 ID382
T6SS typei3
Gene symbol-
Locus tagXBJ1_2101
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]2061568..2062071 [-]
Productsecretion system effector of SST VI cluster (Hcp family)
NoteTssD
UniProt IDD3V3B2
KEGG IDxbo:XBJ1_2101
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.40E-15, Aligned region: 13..143
Protein Sequence: 167 a.a.     [Download]
>gi|290475116|ref|YP_003468000.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MSDFNSMYNTHSFVQFEGIEGESQTKGYEKWIGVQFISRAIINPANGLTDIGSWGSGKGILSHFMLHINY
DKAISALEKYAVTGKHIKTTKIHILRFIGDNEPAIWAKYELTNTYISEIGSGQPSDNVITVGLKMKKFQF
NYTPADYEGKKQAETTWTWDLEKNVIE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c2062071-2061568 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGTCTGATTTCAATTCCATGTATAATACTCATTCTTTCGTTCAATTCGAGGGCATTGAGGGTGAATCGC
AAACTAAAGGTTATGAAAAATGGATCGGTGTCCAATTTATTAGTCGTGCCATAATTAACCCTGCTAATGG
CTTAACCGATATAGGAAGCTGGGGTTCAGGTAAAGGTATTTTAAGCCATTTCATGCTTCATATTAATTAT
GACAAAGCAATAAGCGCCTTAGAAAAATATGCTGTCACGGGTAAACATATTAAGACAACAAAAATTCATA
TACTTCGCTTCATTGGCGATAATGAACCGGCAATATGGGCTAAATATGAACTTACCAATACTTATATTTC
TGAAATCGGCAGTGGACAGCCTTCCGATAATGTCATCACGGTTGGCCTAAAAATGAAAAAATTCCAATTC
AATTACACGCCAGCAGATTATGAAGGTAAAAAACAGGCTGAAACCACCTGGACCTGGGATCTTGAAAAAA
ATGTCATCGAATAA