SecReT6
Protein ID: 290475117
SecReT6 ID382
T6SS typei3
Gene symbol-
Locus tagXBJ1_2102
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]2062237..2063739 [-]
Producthypothetical protein
NoteTssC
UniProt IDD3V3B3
KEGG IDxbo:XBJ1_2102
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-191, Aligned region: 69..495
Protein Sequence: 500 a.a.     [Download]
>gi|290475117|ref|YP_003468001.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MSTTEQETEFQQEQLSKEYTPDELSVLLNKEFRPQSDQARSAVESAVTTLAQQALENTVTISGDTYRTIQ
ALITEIDKKLSQQINHILHHDEFQALEGAWRGLHYLVNNTETDEMLKIRVMCISKKELGSTLKRFKGVSW
DQSPVFKKIYEAEYGQFGGEPYGCLIGDYYFDHTAPDVELLREMAQISAAAHCPFLSGASPSVMQMECWQ
ELSNPRDLTKVFQNTEYAPWHSLRESEDVRYLGLTLPRFLSRLPYGNKTNPVDNFNFEEDTEGPTHSNYT
WANAAYAMAVNINRSFKLYGWCTSIHGVESGGTVENLPCYTFPTDDGGVDIKCPTEIAISDRREAELAKN
GFIPLLHRKNTDMAAFIGAQSLQKPSEYYDHDATANANLSARLPYLFACCRFAHYLKCIVRDKIGTFQER
NDMENWLNNWIINYVDGDPTNSSAGTKARKPLAAAEVQVEEIPSNPGYYHAKFFLRPHYQLEGLTVSLRL
VSRLPSLKST
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c2063739-2062237 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAGTACGACTGAACAAGAAACTGAATTTCAGCAAGAGCAGCTCTCAAAAGAATATACCCCTGATGAAC
TGAGTGTATTGCTGAATAAAGAATTTCGTCCACAAAGCGACCAGGCACGAAGCGCTGTGGAAAGTGCTGT
GACTACATTGGCACAACAGGCGCTGGAAAATACGGTCACAATCTCCGGTGATACCTACCGAACCATTCAA
GCCCTGATTACTGAGATCGATAAAAAACTATCACAGCAAATTAATCATATTTTGCATCATGATGAGTTCC
AAGCGTTGGAAGGGGCTTGGCGAGGGTTGCATTATCTCGTCAATAACACGGAAACCGATGAAATGTTAAA
AATCCGTGTTATGTGTATTTCCAAAAAAGAGTTGGGCAGTACGCTAAAACGTTTCAAAGGTGTGAGCTGG
GATCAAAGCCCTGTCTTTAAAAAAATCTATGAAGCGGAATATGGCCAGTTTGGCGGTGAGCCTTATGGTT
GCCTTATCGGAGATTATTATTTCGATCACACCGCACCCGATGTTGAACTCTTACGGGAGATGGCTCAGAT
TAGTGCCGCCGCGCATTGTCCATTTCTTTCGGGCGCCTCACCAAGTGTGATGCAAATGGAATGCTGGCAA
GAGTTATCTAATCCACGGGATCTCACCAAAGTTTTCCAAAATACCGAATATGCCCCTTGGCATAGTTTGC
GTGAATCGGAAGATGTTCGTTATCTGGGATTAACTTTACCCCGTTTTCTCTCCCGTCTGCCCTATGGTAA
TAAAACAAATCCTGTCGATAATTTTAATTTTGAGGAGGATACCGAAGGCCCTACCCACAGTAACTATACC
TGGGCCAATGCAGCTTATGCTATGGCTGTTAATATCAACCGCTCATTTAAATTATATGGCTGGTGTACTT
CTATCCATGGCGTAGAATCCGGTGGTACTGTAGAAAATTTGCCTTGCTATACTTTCCCAACCGATGATGG
CGGGGTTGATATCAAATGCCCCACCGAAATCGCCATTAGTGATCGCCGTGAGGCTGAATTGGCTAAAAAT
GGTTTTATTCCACTCTTGCATCGTAAAAATACCGATATGGCCGCCTTTATTGGGGCACAATCATTGCAGA
AACCGTCTGAATATTACGACCACGACGCCACCGCTAATGCAAATCTTTCAGCTCGCCTACCTTATTTATT
CGCCTGCTGTCGTTTCGCTCACTATTTAAAATGTATTGTCCGCGATAAAATCGGTACATTTCAGGAACGT
AATGATATGGAGAACTGGCTTAATAACTGGATAATCAATTATGTTGACGGTGATCCGACCAACTCTTCTG
CAGGAACCAAAGCACGAAAACCCTTGGCTGCCGCAGAAGTACAAGTAGAAGAAATCCCAAGTAACCCAGG
ATATTATCACGCTAAATTTTTCCTACGCCCACATTATCAATTAGAAGGATTAACCGTTTCTTTACGTCTG
GTATCAAGATTACCTTCATTAAAAAGCACTTAG