SecReT6
Protein ID: 290475118
SecReT6 ID382
T6SS typei3
Gene symbol-
Locus tagXBJ1_2103
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]2063743..2064294 [-]
Producthypothetical protein
NoteTssB
UniProt IDD3V3B4
KEGG IDxbo:XBJ1_2103
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-58, Aligned region: 9..161
Protein Sequence: 183 a.a.     [Download]
>gi|290475118|ref|YP_003468002.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MKSSGQKFIALNRPPRVQIEYDVELYGSEQKIQLPFVMGVMSDLTGKTLEALPEVNDRKFMEIDLDNFDE
RMKSTQPRVAFQVDNTLTHDGKLNVELIFEKMEDFQPDVIAKKVEPLAKLLEARTQLANLLSYMDGKSGA
EQLIADILQNPALLKSLADAPKPTEGVADTESITDTEEAENKE
 
Nucleotide Sequence: 552 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c2064294-2063743 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAAATCCAGTGGACAAAAGTTTATTGCTCTAAATCGTCCTCCGCGCGTACAGATTGAATATGATGTCG
AGCTTTATGGTTCAGAACAAAAAATTCAATTGCCGTTTGTTATGGGGGTGATGAGCGACTTAACAGGAAA
AACATTAGAGGCTCTACCGGAAGTGAATGACCGCAAATTCATGGAAATTGATCTTGATAATTTTGATGAA
CGCATGAAATCAACACAGCCCCGTGTTGCTTTCCAGGTGGACAATACACTAACCCATGATGGGAAACTGA
ATGTCGAATTAATTTTTGAAAAAATGGAAGATTTTCAGCCTGATGTGATTGCTAAAAAAGTGGAACCCCT
AGCTAAGTTACTGGAGGCGCGAACCCAACTGGCAAACCTATTATCCTATATGGATGGCAAAAGCGGCGCA
GAACAATTGATCGCCGATATCCTGCAAAATCCTGCTCTGCTGAAATCACTGGCCGATGCACCAAAACCCA
CCGAAGGTGTTGCTGATACTGAGAGTATCACCGACACAGAAGAGGCTGAAAATAAGGAGTAA