SecReT6
Protein ID: 290475121
SecReT6 ID382
T6SS typei3
Gene symbol-
Locus tagXBJ1_2106
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]2069231..2070442 [-]
Producthypothetical protein
NoteTssL
UniProt IDD3V3B7
KEGG IDxbo:XBJ1_2106
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.00E-66, Aligned region: 19..224
DUF2077 [PF09850], Evalue: 6.00E-66, Aligned region: 363..389
OmpA [PF00691], Evalue: 1.90E-15, Aligned region: 290..388
Protein Sequence: 403 a.a.     [Download]
>gi|290475121|ref|YP_003468005.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MTPNTPNRHTELSGDIWDNPLVTAANPLLNSIPQIRHDTESPDPTVLRRKLIDEIRHFELKCQYAKLPYE
VIIGARYCLCTTLDEAAALTPWGVRSVWSGSGLLVTFHNETWGGEKLFQLLATLSQSPQKNLLLLELINF
CLQLGFEGRYRVMDNGRTQLETLKQRLFQLIYSVRGNYPPELSPALQKIVAPNSPCQSSFPVWSFIAMTC
LIACILYIGLNWQLDNITSPILTKIYQVNLPNMSVDDHVSSFLPPVLNLQDMLRRESAAGLLNVTNLADR
SIVTLRGDGLFNTGSTQIKNNELPVIKHIAETINNIKGEILVIGYTDDVPINSSGFSSNYALSLARAKSV
KREFEKYLDHPERVRTEGRGESDPLFPNDTPSHRAKNRRVEIVLLISPTHQTT
 
Nucleotide Sequence: 1212 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c2070442-2069231 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGACTCCAAACACTCCCAACAGGCATACGGAGCTTTCTGGCGACATTTGGGATAATCCATTAGTCACTG
CCGCTAACCCTCTATTAAATAGCATTCCTCAGATCCGCCATGATACCGAGTCCCCGGATCCAACCGTTCT
ACGGCGAAAACTGATCGATGAAATTCGCCACTTTGAACTGAAATGCCAATATGCCAAATTGCCTTATGAA
GTCATTATCGGTGCACGTTACTGTCTGTGCACCACATTGGATGAAGCGGCAGCACTGACTCCGTGGGGCG
TTCGCAGTGTCTGGTCCGGCAGTGGATTGCTGGTCACGTTTCACAACGAAACGTGGGGAGGGGAAAAACT
TTTCCAGTTATTAGCGACGTTATCCCAAAGTCCCCAAAAAAATCTGTTGTTGTTAGAACTCATTAACTTT
TGTCTCCAGCTTGGGTTTGAAGGGCGTTATCGTGTCATGGATAATGGGCGAACCCAGTTGGAAACCTTGA
AACAGCGCCTGTTCCAGTTAATTTATTCCGTTCGTGGCAATTATCCGCCTGAATTATCACCAGCATTGCA
AAAAATCGTCGCGCCAAATAGCCCCTGCCAATCTTCCTTCCCTGTTTGGTCCTTTATCGCTATGACCTGT
CTTATTGCATGTATTCTGTATATCGGACTGAATTGGCAGTTGGATAATATAACCAGCCCAATATTGACGA
AAATATATCAAGTCAATTTGCCCAATATGTCCGTTGATGATCACGTTTCTTCTTTCCTGCCGCCGGTCTT
AAATTTACAGGATATGCTCAGACGTGAAAGTGCTGCGGGATTATTAAATGTAACGAATTTAGCGGATAGA
AGTATCGTCACATTAAGAGGCGATGGTTTGTTCAATACGGGTTCCACTCAAATTAAAAACAATGAACTTC
CCGTCATCAAACATATTGCTGAGACAATAAACAACATCAAGGGGGAAATTTTAGTTATTGGTTATACCGA
TGATGTTCCCATTAATAGCTCCGGCTTCTCATCCAATTATGCCTTATCACTCGCCAGAGCCAAATCAGTA
AAAAGGGAATTCGAAAAATATCTGGATCACCCTGAACGGGTAAGAACAGAAGGAAGAGGAGAAAGTGATC
CCCTATTTCCAAACGATACGCCCAGTCATCGAGCTAAAAACAGACGGGTTGAAATCGTTCTGTTAATTTC
CCCTACACATCAGACAACGTGA