SecReT6
Protein ID: 290475122
SecReT6 ID382
T6SS typei3
Gene symbol-
Locus tagXBJ1_2107
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]2070486..2071829 [-]
Producthypothetical protein
NoteTssK
UniProt IDD3V3B8
KEGG IDxbo:XBJ1_2107
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-141, Aligned region: 19..442
Protein Sequence: 447 a.a.     [Download]
>gi|290475122|ref|YP_003468006.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MSRSEKVIWTEGMFLRPHHFQQAENYLETYVRDWGMAQRPYYWGFLTLKLDQSLLEQGKVMVASASGIFP
DGTPFNFTEAHAPVPLQLAENQTGENVVLALPIFRGGREEIIFQERKDSMARFVSVDAEVNDFNAMSVGS
TTVQFGRMRLRLMLESDLTPEWTSLSIVHVISRTRDNKLLLDSRFIPPLLNCHAHPQLVSFINDLQGLLE
QRRQQTSQCLLQLGQQNSSEIMYFLFLSLVNRYSGQVSHTRNIPLLHPERLFSEWLQFATELASFSQSRI
PEDKLPIYDHDNLQVCFNHLMFLLRQGLSIILEEHALQLPLTEYSHGLNVATLTDANMLNTFSFVLAVYA
DTPKETLISRFPAQMKIAPVGRIRELVQLQLPGIPISAMPSVPRQIPWHSGCLYFELEKEGELWSQMAKS
GGFALHLAGEFPGLHMEFWAVRNQSKS
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c2071829-2070486 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAGCAGATCAGAAAAAGTTATCTGGACAGAAGGCATGTTCTTACGCCCTCACCACTTTCAACAGGCCG
AAAACTATCTGGAGACTTATGTCCGCGATTGGGGTATGGCTCAAAGGCCATATTACTGGGGCTTTTTAAC
GTTAAAGTTAGATCAATCATTACTCGAACAGGGCAAGGTCATGGTTGCATCAGCCAGTGGAATTTTTCCT
GACGGGACACCCTTTAATTTTACCGAGGCGCACGCCCCTGTTCCATTACAACTTGCAGAAAATCAAACTG
GAGAAAATGTCGTATTGGCACTGCCGATCTTTCGCGGAGGAAGGGAAGAGATCATTTTTCAGGAAAGAAA
AGACTCTATGGCACGTTTTGTCAGCGTTGACGCCGAGGTCAATGATTTTAATGCCATGTCAGTCGGAAGT
ACCACCGTGCAATTTGGCAGAATGCGCCTGCGGCTGATGTTGGAATCAGATCTGACTCCGGAATGGACGT
CACTCAGTATTGTGCATGTTATCAGTAGAACCCGTGATAATAAATTGCTCCTTGATTCACGCTTCATTCC
GCCCTTACTCAACTGCCATGCACATCCACAACTTGTCAGTTTTATTAATGATTTACAGGGATTACTGGAG
CAACGCCGCCAACAGACAAGCCAGTGTTTGTTACAATTGGGGCAACAAAATAGTTCGGAAATCATGTATT
TTCTTTTCTTGTCATTAGTCAATCGTTATAGCGGCCAAGTGAGCCATACCCGGAATATTCCCTTACTGCA
TCCAGAACGGTTATTCAGTGAATGGCTGCAATTTGCCACCGAACTGGCAAGTTTTTCCCAATCACGAATA
CCAGAAGATAAACTTCCGATTTATGACCATGACAATTTGCAAGTCTGTTTCAACCACCTCATGTTTTTAT
TACGCCAAGGGTTATCCATTATTCTGGAAGAACACGCTCTCCAGTTGCCTTTGACTGAGTATTCTCATGG
GCTGAATGTGGCGACCTTAACTGACGCCAATATGCTAAATACATTCAGCTTTGTATTGGCCGTTTATGCC
GATACGCCGAAAGAAACACTCATCTCCCGTTTTCCGGCACAGATGAAAATTGCCCCTGTTGGCCGCATAC
GTGAACTGGTTCAGTTACAGTTACCCGGTATCCCGATCAGTGCAATGCCATCCGTTCCCAGACAAATTCC
CTGGCATTCCGGTTGCCTCTATTTTGAGTTAGAAAAAGAGGGTGAACTCTGGAGCCAGATGGCAAAATCC
GGTGGTTTTGCGTTACATCTGGCAGGTGAATTTCCGGGTCTGCACATGGAATTTTGGGCTGTTAGAAATC
AGTCCAAAAGTTGA