SecReT6
Protein ID: 290475123
SecReT6 ID382
T6SS typei3
Gene symbol-
Locus tagXBJ1_2108
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]2071856..2072365 [-]
Producthypothetical protein
NoteTssJ
UniProt IDD3V3B9
KEGG IDxbo:XBJ1_2108
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-25, Aligned region: 19..158
Protein Sequence: 169 a.a.     [Download]
>gi|290475123|ref|YP_003468007.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MVILFLHVLVFNLIIFNIFVLTGCSSSEQKKSPPYQLIFRATNNVNDSAPLKIHVILLKSTSEFMSADFF
SLQGHAQAVLGNKLINSEQLFLLPFQHKYFLLEKNIPEANSIGIFAEYKQLDGKKWRIALPVPIPEPPAF
YKFWTSPPDTLDICIQVTANGLNFIDKCN
 
Nucleotide Sequence: 510 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c2072365-2071856 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGTAATACTGTTTCTTCACGTACTCGTATTTAATTTAATAATATTTAACATCTTCGTATTAACAGGGT
GTTCATCATCCGAGCAGAAAAAATCGCCCCCTTATCAATTGATTTTTCGTGCCACAAATAATGTGAATGA
CTCAGCTCCGCTGAAAATACACGTTATTTTGTTGAAATCGACTTCAGAGTTTATGTCTGCTGATTTTTTT
TCACTGCAAGGTCATGCTCAGGCTGTACTGGGTAATAAATTGATTAATTCTGAGCAACTTTTTTTACTGC
CTTTTCAGCACAAATATTTCTTGTTGGAAAAAAACATACCAGAAGCCAATTCTATCGGCATTTTTGCTGA
ATATAAGCAATTGGATGGGAAAAAATGGCGTATCGCATTACCGGTTCCCATTCCTGAGCCTCCCGCTTTC
TATAAATTTTGGACATCACCGCCAGACACATTAGATATATGCATTCAAGTCACCGCCAATGGCCTAAATT
TCATCGATAAATGCAATTAA