SecReT6
Protein ID: 290475129
SecReT6 ID382
T6SS typei3
Gene symbol-
Locus tagXBJ1_2114
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]2077318..2079234 [-]
Producthypothetical protein
NoteTssI
UniProt IDD3V3C5
KEGG IDxbo:XBJ1_2114
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.70E-66, Aligned region: 24..329
Phage_GPD [PF05954], Evalue: 5.70E-66, Aligned region: 537..577
Phage_base_V [PF04717], Evalue: 1.60E-20, Aligned region: 371..464
Attacin_C [PF03769], Evalue: 0.0021, Aligned region: 383..397
Attacin_C [PF03769], Evalue: 0.0021, Aligned region: 527..606
Protein Sequence: 638 a.a.     [Download]
>gi|290475129|ref|YP_003468013.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MERIIIAHSSLGDESLIFKSLKGREKLSTIYSFEVELFSEKKDLDIKELRNKPLSIEIKNSTNISEKPRF
LSGIIREATICDYYDHYYYLYKVIIQPELFILTLNKDFRIWQKKTVPEIISDVLNKYKIKFKNELNAKYQ
PLEYCTQYKETDFDFLSRLMEREGIYYYFQHDKNDHTLILADSPQSHSALPEQASIEYYPSHFSPKNKDK
YYLYDWIVSYSINPKLYTMSDYNFLKPNAQLKETQQNPDPTVPKTELFEWPGNYTENAQGQFYVRVLQQS
YTAQDLYIKAKSVESGIAPGYTFTLSKALRDGDNGDYLIVSANYEFHENPYILGDNEVDADNINKIITEF
TAIPAKVNWRAPRTTSWPIAGTERATVVGASGKTIWTDEHGRVKLKFHWDRSDIKDDKSSCWIRVSNNWA
GSKFGVIQVPRVGEEVIVNFINNNPDEPLVVGRSFNQNNMPPWELPAEATKMGIMSRSLEGGKDNASYLL
IDDAQGKESFEIHAEKDMTVSVEHDQTVSIDGASITKIKNKQQTTVTNGKEVEVTSGGIQYKITDGYKAD
ITGDKSEKISSSYQLEVGRNFANNISGNYNLNITGNKKESVTGNAEIKASKLSLASSTTIDINGAAKISI
TAGLILLG
 
Nucleotide Sequence: 1917 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c2079234-2077318 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGAAAGGATCATTATAGCTCACTCCTCATTAGGCGATGAATCCCTGATATTTAAGTCATTGAAAGGAA
GGGAAAAATTATCAACTATTTATAGTTTTGAAGTGGAGCTTTTCAGTGAAAAGAAGGATCTTGACATCAA
AGAGTTACGAAACAAACCCCTGTCAATAGAGATAAAAAATTCTACAAATATTTCAGAAAAACCCCGCTTT
TTAAGTGGAATTATCCGTGAAGCCACTATTTGTGATTATTATGACCATTACTACTATTTATATAAGGTGA
TTATCCAGCCTGAGTTGTTCATTCTCACTTTAAACAAAGATTTCAGAATCTGGCAGAAAAAGACGGTGCC
TGAAATTATTTCAGACGTTCTTAATAAATATAAAATAAAGTTTAAAAATGAACTCAATGCGAAATACCAG
CCATTAGAATATTGCACCCAATATAAAGAAACTGATTTCGATTTTTTAAGTCGGTTAATGGAACGTGAAG
GAATTTATTACTATTTCCAACACGATAAGAATGATCACACGCTTATATTGGCTGATTCCCCCCAATCCCA
TTCAGCCTTACCAGAGCAGGCTTCTATTGAATATTATCCAAGCCATTTTTCACCGAAAAACAAAGACAAA
TATTATCTATACGACTGGATTGTAAGTTATTCAATCAATCCCAAGCTCTATACCATGAGTGACTATAACT
TCCTTAAGCCAAATGCACAGCTAAAAGAAACTCAGCAGAATCCAGATCCGACAGTGCCAAAAACAGAGCT
GTTTGAGTGGCCAGGGAATTATACCGAAAATGCGCAAGGACAATTTTATGTCCGAGTACTACAACAATCC
TATACCGCGCAGGATCTGTATATAAAAGCGAAAAGCGTAGAATCCGGCATTGCGCCAGGCTACACCTTCA
CATTATCAAAAGCCCTGCGGGATGGAGACAACGGCGACTATCTTATTGTCAGTGCCAATTATGAGTTTCA
TGAAAATCCCTATATTCTGGGAGACAATGAGGTTGATGCCGACAACATAAATAAAATTATCACTGAGTTC
ACCGCCATCCCCGCTAAAGTCAACTGGCGTGCTCCTCGCACAACATCATGGCCCATAGCAGGTACTGAAC
GAGCTACCGTTGTCGGGGCAAGCGGCAAAACCATTTGGACTGATGAACATGGCAGAGTCAAACTCAAGTT
TCACTGGGACAGAAGCGATATAAAAGACGATAAAAGTTCCTGTTGGATACGGGTATCCAACAATTGGGCG
GGATCAAAGTTTGGGGTAATTCAGGTGCCAAGAGTGGGGGAAGAAGTTATCGTCAATTTCATTAATAACA
ACCCAGACGAACCATTGGTTGTGGGGCGCAGTTTCAACCAAAACAATATGCCTCCCTGGGAATTACCCGC
AGAAGCCACCAAAATGGGGATAATGTCACGGAGTTTAGAGGGCGGAAAAGATAATGCCAGTTATTTGTTG
ATTGATGATGCTCAAGGAAAAGAATCCTTCGAAATACATGCCGAGAAAGACATGACAGTCTCAGTGGAAC
ACGATCAAACCGTTTCCATTGATGGGGCATCTATCACAAAGATCAAAAACAAACAACAAACTACCGTGAC
CAATGGCAAGGAAGTCGAAGTCACCAGTGGTGGTATTCAATATAAAATTACTGACGGATATAAAGCAGAT
ATCACGGGTGATAAATCAGAAAAAATCAGCAGCTCTTATCAGTTAGAGGTTGGACGCAATTTTGCTAACA
ACATCAGTGGAAATTACAACCTGAATATTACGGGGAATAAGAAAGAGTCAGTGACAGGAAACGCCGAAAT
TAAAGCAAGCAAGTTGTCCTTGGCATCGAGTACCACAATAGATATTAACGGTGCAGCAAAGATTTCCATA
ACGGCGGGACTCATTCTATTGGGTTAA