SecReT6
Protein ID: 291281037
SecReT6 ID383
T6SS typei1
Gene symbolyhhZ
Locus tagG2583_0225
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]243492..243971 [-]
Producthypothetical protein
NoteTssD
UniProt IDD3QWL5
KEGG IDeok:G2583_0225
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.30E-31, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|291281037|ref|YP_003497855.1| hypothetical protein G2583_0225 [Escherichia coli O55:H7 str. CB9615]
MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFMHGLNRDQNVNHHHLTIKKPIDKASP
LLGKAICDNELLTCDFSFYRTNKFGINELYYKIKLTGAKISDIHVSISHIVVDNSVQPEESVSFSYESII
WEHCSAGTSAYSLWEDRLF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c243971-243492 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGGCGAATTTAATTTATTTAACACTAAATGGTGATAATCAAGGGCTCATTTCAAGTGGTTGTTCATCAC
AACCATCCATTGGAAATAAAGCTCAAACAGCACACATTGATCAAATTATGATTTATGAATTCATGCATGG
ATTAAATCGAGATCAAAACGTCAACCATCATCATTTGACAATAAAAAAACCTATAGATAAAGCATCACCC
TTATTAGGCAAAGCAATTTGCGACAATGAATTATTGACATGTGATTTTTCCTTTTATCGTACAAATAAAT
TTGGAATTAATGAACTGTACTATAAAATCAAATTAACTGGAGCAAAGATAAGCGACATTCATGTCTCTAT
ATCACATATTGTTGTTGATAACAGCGTTCAACCCGAAGAGTCAGTTTCTTTCAGTTATGAGTCAATTATA
TGGGAGCATTGTTCCGCTGGCACTAGTGCATACAGTTTATGGGAAGATCGTCTTTTTTAA