SecReT6
Protein ID: 291281037
SecReT6 ID383
T6SS typei1
Gene symbolyhhZ
Locus tagG2583_0225
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]243492..243971 [-]
Producthypothetical protein
NoteTssD
UniProt IDD3QWL5
KEGG IDeok:G2583_0225
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.30E-31, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|291281037|ref|YP_003497855.1| hypothetical protein G2583_0225 [Escherichia coli O55:H7 str. CB9615]
MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFMHGLNRDQNVNHHHLTIKKPIDKASP
LLGKAICDNELLTCDFSFYRTNKFGINELYYKIKLTGAKISDIHVSISHIVVDNSVQPEESVSFSYESII
WEHCSAGTSAYSLWEDRLF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c243971-243492 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGGCGAATTTAATTTATTTAACACTAAATGGTGATAATCAAGGGCTCATTTCAAGTGGTTGTTCATCAC
AACCATCCATTGGAAATAAAGCTCAAACAGCACACATTGATCAAATTATGATTTATGAATTCATGCATGG
ATTAAATCGAGATCAAAACGTCAACCATCATCATTTGACAATAAAAAAACCTATAGATAAAGCATCACCC
TTATTAGGCAAAGCAATTTGCGACAATGAATTATTGACATGTGATTTTTCCTTTTATCGTACAAATAAAT
TTGGAATTAATGAACTGTACTATAAAATCAAATTAACTGGAGCAAAGATAAGCGACATTCATGTCTCTAT
ATCACATATTGTTGTTGATAACAGCGTTCAACCCGAAGAGTCAGTTTCTTTCAGTTATGAGTCAATTATA
TGGGAGCATTGTTCCGCTGGCACTAGTGCATACAGTTTATGGGAAGATCGTCTTTTTTAA

Protein ID: 291281053
SecReT6 ID383
T6SS typei1
Gene symbol-
Locus tagG2583_0242
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]264076..264594 [+]
ProductHcp
NoteTssD
UniProt IDD3QWN1
KEGG IDeok:G2583_0242
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-34, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0061, Aligned region: 95..136
Protein Sequence: 172 a.a.     [Download]
>gi|291281053|ref|YP_003497871.1| Hcp [Escherichia coli O55:H7 str. CB9615]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPAGQRAHKPFIF
TVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|291280824|ref|NC_013941.1|:264076-264594 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGCCAACACCGTGTTATATCTCCATCACTGGTCAGACCCAGGGAAATATTACTGCAGGTGCATTTACCG
CTGATTCTGTCGGCAACATCTATGTGCAGGGGCACGAAGACGAGATGCTGGTGCAGGAATTCCTGCATAA
CGTTACTGTCCCGACCGATCCTCAGTCCGGTCAGCCTGCGGGTCAGCGTGCTCACAAGCCTTTCATTTTT
ACCGTGGCGCTGAACAAAGCGGTTCCGCTGATGTACAACGCACTGGCCTCCGGCGAAATGCTGCCAACCA
CTGAACTTCACTGGTGGCGTACCTCTGTGGAAGGCAAACAGGAGCATTATTTCACTACCCGCCTGACTGA
TTCGACGATTGTCGATATGAAACTGCATATGCCGCATTGCCAGGACCCGGCGAAACGCGAGTTCACCCAG
TTGCTCGAAGTTTCACTGGCCTACCGCAAAATTGAATGGGAACACGTCAAATCTGGCACCTCCGGTGCCG
ACGACTGGCGCGCACCGCTGGAAGCATAA